PRGDB00049583 (RFO1)

From PRG Wiki
Jump to: navigation, search
RFO1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 68159721 (DQ023268)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana RFO1 (RFO1) gene, complete cds.

DNA Sequence

ATGAAGAGAAGGAGACTTTTTTTCTGTGTTCTACTCTCTATCCTAACTCTGTTCATCAATGGTCCATTGGTAACGACAGCTCAATCTCCACCTTCTTCAACTTCATGTAACCGAATCTGTGGAAGAATCGAGATTCCTTTTCCTTTTGGAATCGGACGAAGAGACTGTTTTCTCAACGACTGGTACGAGGTTGTCTGTAACAGCACCACCTCCGGTAAATCCTTAGCTCCGTTCCTCTATAAGATCAACAGAGAATTAGTTAGCATCACTCTTCGAAGCAGCATCGACAGTTCCTACGGAGTTGTTCACATTAAATCTCCGGTGACTTCCTCCGGCTGTTCTCAACGACCCGTAAAGCCTCTTCCTTTAAACCTCACCGGTAAAGGAAGTCCCTTTTTCATCACCGACTCGAATCGTCTCGTCTCAGTTGGTTGTGACAACAGAGCATTGATTACAGACATCGAATCTCAGATCACAGGATGCGAATCGAGCTGCGACGGAGATAAAAGTCGTTTAGACAAGATCTGCGGTGGTTACACATGTTGTCAGGCGAAGATTCCGGCGGATAGACCGCAAGTAATCGGCGTTGACCTTGAAAGCTCCGGTGGTAACACAACTCAAAGAGGAAACTGTAAAGTTGCTTTCTTGACGAATGAGACTTACTCTCCGGCGAATGTTACAGAGCCGGAACAATTTTATACTAATGGGTTTACAGTGATTGAGCTTGGTTGGTACTTTGATACATCAGATTCTCGGTTAACGAATCCTGTGGGTTGTGTGAATTTGACGGAAACAGGGATTTACACGAGCGCACCGAGCTGTGTTTGTGAGTATGGTTACTTCTCTGGCTTTGGTTACAGTAACTGTTACTGCAATCAGATTGGTTACAGAGGGAATCCTTATCTTCCTGGTGGATGCATTGACATTGACGAATGTGAGGAAGGAAAAGGACTAAGCAGCTGTGGAGAACTAACTTGTGTGAATGTTCCTGGATCGTGGAGGTGCGAGAATGGAGTAGGGAAGATCAAGCCTCTGTTTCCAGGTCTTGTTCTAGGTTTTACACTGTTGTTCTTGGTACTTGGGATATGGGGATTGATCAAGTTCGTTAAGAAGAGAAGGAAGATTATCCGAAAGAGAATGTTCTTTAAACGTAATGGAGGCTTGTTGTTGAAACAACAGTTAACTACAAGAGGAGGTAATGTGGAGTCATCGAAGATATTCAGTTCGAAAGAGCTGGAGAAAGCGACGGATAACTTCAATATGAACAGGGTTCTTGGGCAAGGAGGTCAAGGCACTGTCTACAAAGGAATGTTGGTAGATGGGCGAATTGTTGCTGTGAAAAGATCTAAAGTTTTAGATGAAGATAAAGTTGAGGAGTTTATCAATGAAGTTGGTGTTCTCTCGCAGATTAACCATAGAAATATTGTCAAACTCATGGGGTGTTGTCTCCAGACAGAGGTTCCTATCTTGGTTTATGAACATATTCCAAATGGAGACCTATTCAAGCGGCTTCACCATGATTCTGATGATTACACTATGACTTGGGATGTGCGATTGCGCATCGCTGTTGAGATTGCAGGAGCACTTGCTTACTTGCACTCGGCTGCATCAACTCCGGTCTATCATAGAGATGTCAAGACCACAAACATACTTTTGGATGAGAAGTATAGAGCCAAGGTATCGGATTTCGGGACTTCGAGATCCATAAACGTAGATCAAACTCACTTGACTACTCTAGTTGCAGGTACTTTTGGATACTTGGATCCAGAGTACTTTCAAACTAGCCAGTTTACGGATAAAAGTGATGTTTATAGTTTTGGGGTCGTCTTGGTTGAGCTCATAACTGGAGAAAAGCCGTTTTCTGTAATGCGGCCTGAAGAAAACAGAGGACTTGTGTCTCATTTCAATGAGGCTATGAAACAGAACAGAGTTCTTGATATTGTTGATTCTCGGATCAAAGAAGGTTGCACGTTGGAACAAGTGTTGGCTGTGGCGAAACTTGCCAGAAGGTGTTTAAGTCTAAAAGGGAAGAAACGACCAAATATGAGAGAGGTTTCAATTGAGCTTGAGAGGATCCGTTCATCACCTGAAGATTTGGAGTTACATATTGAAGAGGAGGACGAAGAAGAATGCGCCATGGAAATCAACATGGATGATTCTTGGAGCGTCGACATGACTGCTCCAGCTTCCCTCTTTGATTTATCGCCCAAGTTAGACGTTGAACCGCTGGTTCCTCAACGAACATGGTGA


Protein sequences

Name Description Sequence
RFO1 RFO1 [Arabidopsis thaliana].

MKRRRLFFCVLLSILTLFINGPLVTTAQSPPSSTSCNRICGRIEIPFPFGIGRRDCFLNDWYEVVCNSTTSGKSLAPFLYKINRELVSITLRSSIDSSYGVVHIKSPVTSSGCSQRPVKPLPLNLTGKGSPFFITDSNRLVSVGCDNRALITDIESQITGCESSCDGDKSRLDKICGGYTCCQAKIPADRPQVIGVDLESSGGNTTQRGNCKVAFLTNETYSPANVTEPEQFYTNGFTVIELGWYFDTSDSRLTNPVGCVNLTETGIYTSAPSCVCEYGYFSGFGYSNCYCNQIGYRGNPYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCENGVGKIKPLFPGLVLGFTLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVESSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSIELERIRSSPEDLELHIEEEDEEECAMEINMDDSWSVDMTAPASLFDLSPKLDVEPLVPQRTW

Domains

Domain Start-End Description Sequence

HMMPfam: PF13947
IPR025287
34-146 GUB_WAK_bind
Wall-associated receptor kinase galacturonan-bindi

TSCNRICGRIEIPFPFGIGRRDCFLNDWYEVVCNSTTSGKSLAPFLYKINRELVSITLRSSIDSSYGVVHIKSPVTSSGCSQRPVKPLPLNLTGKGSPFFITDSNRLVSVGCD

HMMPfam: PF08488
IPR013695
173-278 WAK
Wall-associated kinase

DKICGGYTCCQAKIPADRPQVIGVDLESSGGNTTQRGNCKVAFLTNETYSPANVTEPEQFYTNGFTVIELGWYFDTSDSRLTNPVGCVNLTETGIYTSAPSCVCEY

HMMPanther: PTHR24420
286-720 FAMILY NOT NAMED,FAMILY NOT NAMED

YSNCYCNQIGYRGNPYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCENGVGKIKPLFPGLVLGFTLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVESSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSIELERIRSSPEDLELHIEEEDEEECAMEINMDDS

HMMPanther: PTHR24420:SF444
286-720 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YSNCYCNQIGYRGNPYLPGGCIDIDECEEGKGLSSCGELTCVNVPGSWRCENGVGKIKPLFPGLVLGFTLLFLVLGIWGLIKFVKKRRKIIRKRMFFKRNGGLLLKQQLTTRGGNVESSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSIELERIRSSPEDLELHIEEEDEEECAMEINMDDS

Gene3D: G3DSA:2.10.25.10
308-336 no description

DIDECEEGKGLSSCGELTCVNVPGSWRCE

Seg: seg
344-361 seg

PLFPGLVLGFTLLFLVLG

Seg: seg
366-384 seg

IKFVKKRRKIIRKRMFFKR

superfamily: SSF56112
IPR011009
391-703 Protein kinase-like (PK-like)
Protein kinase-like domain

KQQLTTRGGNVESSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSIELERIRSSPEDLELHI

Gene3D: G3DSA:3.30.200.20
403-480 no description

SSKIFSSKELEKATDNFNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMG

ProfileScan: PS50011
IPR000719
419-692 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSIELERI

HMMSmart: SM00220
IPR002290
419-692 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSIELERI

HMMSmart: SM00219
IPR020635
419-689 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FNMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREVSIEL

HMMPfam: PF00069
IPR000719
420-685 Pkinase,Ser-thr
Protein kinase, catalytic domain

NMNRVLGQGGQGTVYKGMLVDGRIVAVKRSKVLDEDKVEEFINEVGVLSQINHRNIVKLMGCCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREV

Gene3D: G3DSA:1.10.510.10
481-685 no description

CCLQTEVPILVYEHIPNGDLFKRLHHDSDDYTMTWDVRLRIAVEIAGALAYLHSAASTPVYHRDVKTTNILLDEKYRAKVSDFGTSRSINVDQTHLTTLVAGTFGYLDPEYFQTSQFTDKSDVYSFGVVLVELITGEKPFSVMRPEENRGLVSHFNEAMKQNRVLDIVDSRIKEGCTLEQVLAVAKLARRCLSLKGKKRPNMREV

PatternScan: PS00108
IPR008271
540-552 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VYHRDVKTTNILL

Seg: seg
697-710 seg

EDLELHIEEEDEEE


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox