PRGDB00049615 (NBS-type resistance protein)

From PRG Wiki
Jump to: navigation, search
NBS-type resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 29707151 (AY244685)
Gene Class NL
Domain Type NBS, LRR
Gene Species Gossypium barbadense

Comment?

Gossypium barbadense clone 82-5 NBS-type resistance protein gene, partial cds.

DNA Sequence

GGGGTAGGAAAGACGACCATCATGAAGCACATCCACAATGATCTTTTGAAAGAACAACGATTTGAAAGGGTGGTTTGGGTTACTATATCAAAGGAGTTCAATATTGTGAAGTTACAAAATGATATTGCAAGTGCATTGAATGGAAAGATTCCCAAAGAAGCAAACAAGGTCAGACGAGCAGCAATCTTGTCCGAAATGCTGAAGAGAGCAGGAAAGCATGTTCTAATCCTAGATGATGTGTGGAGTGAAGTCTCGTTGGAAGAAATTGGGATCCCTAAGCCAAGTAGCAGCAATGGGTACAAGTTGGTGTTGACAACCCGTGTGGAGCAAGTTTGTAAGTCTATGGGCTGTAAGGTGATAAAAGTGAAGCCCCTTTCAGAAGAAGAGGCATTGATACTATTCTTGAGTGAAGTTGGACCTAACATAGTGCAAAATCAAACTTTAATGCCAACTTTGAAGCTTGTTGTCAAGGAATGTGCAGGTCTGCCTCTAGCCCTC


Protein sequences

Name Description Sequence
NBS-type resistance protein NBS-type resistance protein [Gossypium barbadense].

GVGKTTIMKHIHNDLLKEQRFERVVWVTISKEFNIVKLQNDIASALNGKIPKEANKVRRAAILSEMLKRAGKHVLILDDVWSEVSLEEIGIPKPSSSNGYKLVLTTRVEQVCKSMGCKVIKVKPLSEEEALILFLSEVGPNIVQNQTLMPTLKLVVKECAGLPLAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-153 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVGKTTIMKHIHNDLLKEQRFERVVWVTISKEFNIVKLQNDIASALNGKIPKEANKVRRAAILSEMLKRAGKHVLILDDVWSEVSLEEIGIPKPSSSNGYKLVLTTRVEQVCKSMGCKVIKVKPLSEEEALILFLSEVGPNIVQNQTLMPTLK

Gene3D: G3DSA:3.40.50.300
1-82 G3DSA:3.40.50.300

GVGKTTIMKHIHNDLLKEQRFERVVWVTISKEFNIVKLQNDIASALNGKIPKEANKVRRAAILSEMLKRAGKHVLILDDVWS

HMMPanther: PTHR23155:SF108
1-153 PTHR23155:SF108,SUBFAMILY NOT NAMED

GVGKTTIMKHIHNDLLKEQRFERVVWVTISKEFNIVKLQNDIASALNGKIPKEANKVRRAAILSEMLKRAGKHVLILDDVWSEVSLEEIGIPKPSSSNGYKLVLTTRVEQVCKSMGCKVIKVKPLSEEEALILFLSEVGPNIVQNQTLMPTLK

HMMPfam: PF00931
IPR002182
1-166 NB-ARC,NBS
NB-ARC

GVGKTTIMKHIHNDLLKEQRFERVVWVTISKEFNIVKLQNDIASALNGKIPKEANKVRRAAILSEMLKRAGKHVLILDDVWSEVSLEEIGIPKPSSSNGYKLVLTTRVEQVCKSMGCKVIKVKPLSEEEALILFLSEVGPNIVQNQTLMPTLKLVVKECAGLPLAL

superfamily: SSF52540
1-166 SSF52540

GVGKTTIMKHIHNDLLKEQRFERVVWVTISKEFNIVKLQNDIASALNGKIPKEANKVRRAAILSEMLKRAGKHVLILDDVWSEVSLEEIGIPKPSSSNGYKLVLTTRVEQVCKSMGCKVIKVKPLSEEEALILFLSEVGPNIVQNQTLMPTLKLVVKECAGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox