PRGDB00049624 (dihydroflavonol-4-reductase)

From PRG Wiki
Jump to: navigation, search
dihydroflavonol-4-reductase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28912775 (AF490387)
Gene Class Unknown
Domain Type
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) dihydroflavonol-4-reductase gene, partial cds.

DNA Sequence

ATGCTGAGCATCATGCGGGCCTGCAGGGACGCCGGCGCCGTCAAGCGCATTGTCTTCACCTCCTCCGCCGGGACCGTCAACATCGAGGAGCGGCAGCGCCCCTCCTACGACCACGACGACTGGAGCGACATCGACTTCTGCCGCCGCGTCAAGATGGCCGGATGGATGTACTTCGTGTCCAAGTCATTGGCGGAGAAGGCCGCCATGGAATACGCGAGGGAGCACAGGCTGGGCCTCATCAGCGTCATCCCCACGCTCGTCGTCGGGCCCTTCATCAGCAACGGGATGCCGCCGAGCCACGTCACCGCGCTGGCGCTGCTCACGGGGAACGGGGCCCACTACTCGATCCTGAAGCAGGTGCAGTTCGTCCACCTCGACGACCTCTGCGACGCCGAGATCTTCCTCTTCGAGAGCCCCGAGGCGCGCGGCCGCTACGTCTGCTCCTCCCACGACGCCACCATCCACGGCCTCGCGACGATGCTCGCGGACATGTTCCCGGAGTACGACGTGCCGCGGAGCTTTCCCGGGATCGACGCCGACCACCTCCAGCCGGTGCACTT


Protein sequences

Name Description Sequence
dihydroflavonol-4-reductase dihydroflavonol-4-reductase [Oryza sativa (indica cultivar-group)].

MLSIMRACRDAGAVKRIVFTSSAGTVNIEERQRPSYDHDDWSDIDFCRRVKMAGWMYFVSKSLAEKAAMEYAREHRLGLISVIPTLVVGPFISNGMPPSHVTALALLTGNGAHYSILKQVQFVHLDDLCDAEIFLFESPEARGRYVCSSHDATIHGLATMLADMFPEYDVPRSFPGIDADHLQPVH

Domains

Domain Start-End Description Sequence

superfamily: SSF51735
1-176 NAD(P)-bd

MLSIMRACRDAGAVKRIVFTSSAGTVNIEERQRPSYDHDDWSDIDFCRRVKMAGWMYFVSKSLAEKAAMEYAREHRLGLISVIPTLVVGPFISNGMPPSHVTALALLTGNGAHYSILKQVQFVHLDDLCDAEIFLFESPEARGRYVCSSHDATIHGLATMLADMFPEYDVPRSFPG

HMMPanther: PTHR10366:SF9
1-174 PTHR10366:SF9,CINNAMOYL-COA REDUCTASE

MLSIMRACRDAGAVKRIVFTSSAGTVNIEERQRPSYDHDDWSDIDFCRRVKMAGWMYFVSKSLAEKAAMEYAREHRLGLISVIPTLVVGPFISNGMPPSHVTALALLTGNGAHYSILKQVQFVHLDDLCDAEIFLFESPEARGRYVCSSHDATIHGLATMLADMFPEYDVPRSF

HMMPanther: PTHR10366
1-174 PTHR10366,NAD DEPENDENT EPIMERASE/DEHYDRATASE

MLSIMRACRDAGAVKRIVFTSSAGTVNIEERQRPSYDHDDWSDIDFCRRVKMAGWMYFVSKSLAEKAAMEYAREHRLGLISVIPTLVVGPFISNGMPPSHVTALALLTGNGAHYSILKQVQFVHLDDLCDAEIFLFESPEARGRYVCSSHDATIHGLATMLADMFPEYDVPRSF

Gene3D: G3DSA:3.40.50.720
IPR016040
2-96 NAD(P)-bd
NAD(P)-binding domain

LSIMRACRDAGAVKRIVFTSSAGTVNIEERQRPSYDHDDWSDIDFCRRVKMAGWMYFVSKSLAEKAAMEYAREHRLGLISVIPTLVVGPFISNGM

HMMPfam: PF01370
IPR001509
2-146 Epimerase
NAD-dependent epimerase/dehydratase

LSIMRACRDAGAVKRIVFTSSAGTVNIEERQRPSYDHDDWSDIDFCRRVKMAGWMYFVSKSLAEKAAMEYAREHRLGLISVIPTLVVGPFISNGMPPSHVTALALLTGNGAHYSILKQVQFVHLDDLCDAEIFLFESPEARGRYV


List of References

Wei-Dong Liu, Shi-Ping Wang
[Analysis and mapping of homologous sequences of barley disease resistance gene Mlo and maize disease resistance gene Hm1 in rice].
Yi Chuan Xue Bao: 2002, 29(10);875-9
PubMed:12561471 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox