PRGDB00049625 (Mlo)

From PRG Wiki
Jump to: navigation, search
Mlo
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28912773 (AF490386)
Gene Class Mlo-like
Domain Type MLO
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Mlo gene, partial cds.

DNA Sequence

GGCAAGGTGGCGCTGATGTCGGCAAAGAGCATGCACCAGCTGCACATTTTCATCTTCGTGCTCGCCGTGTTCCATGTTACCTACTGCGTCATCACCATGGGTTTAGGGCGCCTCAAAATGAAGAAATGGGAAGAAGTGGGAGTCACAAGACCAACTCATTGGAGTACCAAGTTCGCAATCGATCCTTCACGATTCAGGTTCACGCATCAGACGTCGTTCGTGAAGCGGCATCTGGGATCATTCTCAAGCACCCCTGGGCTCAGATGGATCGTAGCATTCTTCAGGCAGTTCTTTGGGTCCGTCACCAAGGTGGACTACCTGACCATGCGGCAAGGCTTCATCAAT


Protein sequences

Name Description Sequence
Mlo Mlo [Oryza sativa (japonica cultivar-group)].

GKVALMSAKSMHQLHIFIFVLAVFHVTYCVITMGLGRLKMKKWEEVGVTRPTHWSTKFAIDPSRFRFTHQTSFVKRHLGSFSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFIN

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
1-115 Mlo
Mlo-related protein

GKVALMSAKSMHQLHIFIFVLAVFHVTYCVITMGLGRLKMKKWEEVGVTRPTHWSTKFAIDPSRFRFTHQTSFVKRHLGSFSSTPGLRWIVAFFRQFFGSVTKVDYLTMRQGFIN


List of References

Wei-Dong Liu, Shi-Ping Wang
[Analysis and mapping of homologous sequences of barley disease resistance gene Mlo and maize disease resistance gene Hm1 in rice].
Yi Chuan Xue Bao: 2002, 29(10);875-9
PubMed:12561471 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox