PRGDB00049626 (disease resistance-like protein)

From PRG Wiki
Jump to: navigation, search
disease resistance-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 24459842 (AJ298885)
Gene Class NL
Domain Type NBS, LRR
Gene Species Coffea arabica

Comment?

Coffea arabica partial ORF for disease resistance-like protein, clone NBS ArgaB1.

DNA Sequence

GGGGGTGGGGAAGACGACACTAGCCAAAAAAGTCTTACATGACCCAAAAATTGAGTATGATTTCTTCACCCGTGCATTTATCTATGTTTCTCAGCAATTTGAGAGAACTGAGGTGTTCCTCAATATTCTGTGGTCTATTGGCCATCTCACTAAGAAAGCGCAAAATATGCCAGAAGAAAAATTAGCAGAACATGTTCGTGAACAATTGAAGACTAGAATGTACTTGATAGTTATGGATGATGTGTGGAAGATAGAGGACTGGGATAAACTCAAAGTAGCTTTTCCGAATAATAAGAAGCGCAGCAGAGTCTTGATTACTACTAGAAACACCTCCGTGGCTATTTATGCAAATCCAGTTGAGCCATATCACTTGGACTTTCTAACTTTTGATGCCAGTCGAGAGTTACTACGGAGAAAGGTTTTTGGTGAGAACAAGTGCCCCGAAGAAGTGGAACAATATGAAGTGCATATGGTAAAGAAATGTGATGGACTGCCCCTCGTCCC


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Coffea arabica].

GVGKTTLAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYHLDFLTFDASRELLRRKVFGENKCPEEVEQYEVHMVKKCDGLPLVP


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
1-107 G3DSA:3.40.50.300

GVGKTTLAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITT

HMMPanther: PTHR11017:SF20
1-166 PTHR11017:SF20,SUBFAMILY NOT NAMED

GVGKTTLAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYHLDFLTFDASRELLRRKVFGENKCPEEVEQYEVHMVKKCDGLPL

HMMPfam: PF00931
IPR002182
1-167 NB-ARC,NBS
NB-ARC

GVGKTTLAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYHLDFLTFDASRELLRRKVFGENKCPEEVEQYEVHMVKKCDGLPLV

HMMPanther: PTHR11017
1-166 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVGKTTLAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYHLDFLTFDASRELLRRKVFGENKCPEEVEQYEVHMVKKCDGLPL

superfamily: SSF52540
1-167 SSF52540

GVGKTTLAKKVLHDPKIEYDFFTRAFIYVSQQFERTEVFLNILWSIGHLTKKAQNMPEEKLAEHVREQLKTRMYLIVMDDVWKIEDWDKLKVAFPNNKKRSRVLITTRNTSVAIYANPVEPYHLDFLTFDASRELLRRKVFGENKCPEEVEQYEVHMVKKCDGLPLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox