PRGDB00049632 (Rpg1)

From PRG Wiki
Jump to: navigation, search
Rpg1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21929726 (AF509751)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare subsp. vulgare 80-TT barley stem rust resistance protein (Rpg1) gene, complete cds.

DNA Sequence

ATGATGCGAAGGATGGTGATGAAGGTGGCGCTGGAGGACAGGAGCCAGCAGCGGAAGGCGCTCAAAGCAGTCTCCACTCTACATGGTATCGACGCGATTGCCGCGGACTTGCGGTGCGGGACGATCACGGTCGTCGGCGTCGTCGACCCCGTCGACGTCGTGGCCAAGCTGCGAAGGTTGTTTGCCAACGCTCAGATCGTCTCCGTCGGGCCGGCCAAAGAGGAGAAGAAGGACGGCGACAAGAAGGACGGCGCCGACAAGAAGAAGCCCGTACCGGTCCCGCCGGTGTACTATCCCTTTCCCTACTATCCGCCCCCTCGTCCTCGGTACGAGTTTACAGTCGGGTTCTTGAACAGCATCACAGACAATTTCTCCGAGGCGCGCATCATTGTCCGTGGTCGGCATGGAATAGTCTACAAGGGAGTGCTGGACAATGGGCAGTACATTGCTGTGAAGAAGCTTCACCTCATGCCGGGGCTGGACGATGAGGAATTCAAAAACGAGTTTAATAATCTTATGAGGGTCCGACATCAAAATATCATACCGTTGGTTGGTTACTGCCATCACACAAAACAGGTGCTTGTTGAGCACAATGGAAAGCATGTTTCTGCTCGAGTAGAAGAAAGATATTTATGCTCCGAATACTTGGAGGGAGGAAGCCTTGACAAGCATCTTTCTAATGAACCATGCGCACTTGCTTGGTACACATGTTACAAAATAATTAAAGGCATCTGTGATGGTTTACTTTGCCTTCACAAGGGATTCCAAGAGCCTATTTGGCATTTAGAATTAAAACCTACAAAAATTTTGCTGGATAAGGACATGATGCCCAAAATTGGAGGTTTTGGTTTCTCTAGACTCTTTGATTCAATAGAAACCTCCAGCACATCAGAAGTTAGGGGAACAAGTGTATATATGCCACCAGAATACATCAGTAAACGGCTAATCACATCAAGTAATGTATTCAGTCTGGGTGTCATAATCTTGCAAATTATGGCAGGAAAGGAGAGCTATACCAAATGTGTAGACATTCCACCCGAAGAGTTTACTGAGCGTGTATATGGATTCTGGGTAAATAGGATGCCGGGCACAGTATCGAAGCATACTTCCAATGAAGTTAAAACATGCATCGAAATAGCTCTAAAATGCGTGGAGTCCAATCGAGTGAACAGGCCTACTATAAATGAGATCATACAAAGGATGGATAAGATTGATATTGTTGAGTGCTCATCTTTAGGTGATCTATATAAGACAAGGGAGTTTGCATTCGAGTTCTTAGAACATATTACAAATGTTTTTTCTGAGAAGAACATAATTGGTCGTGGTGCATGTGGGGTTATTTACAAGGGAGTGTTGGACAATGGAGAAGAAATTGCTGTTAAGAAACTTCATCAAACGTTGTCTATTGATGATGGGCTATTTAAGAAAGAGGTTAATAATGTAATGAGGGCCGAACATAAAAATATTGTACGGTTAGTTGGCTACTGCCACCATATATCACCAATAATTGTTGAGCACGAAGGAAAACATGTTTCTGCTAGTGTGATAGAAAGAGTGATTTGTTTCGAATACATGCAACGAGGAAGCCTTGACGACCAACTTTCAGCTGAATCCTGCAAACTTGATTGGGACAGATGTTACAAAATAATAAAAGGAATATGTGAGGGGTTACATTACCTTCATAATGCTGTCCCTCCCATTTACCATGGGGACTTAAAACCCGGAAATATTTTGCTGGATAAGGATATGGTGGCAAAGATCGGTGATTTTGGTTTGTCAAGAGTCTTTGATACAACGCAAACCTATATGACAACATCCGGAGTTATTAAAGGAACACCTGGATACATGTCACCAGAATACATCAATGAACATAAGATCAGTCTGAAGTCTGATGTATTTGCTCTCGGGGTCATAATCATAAAAATGATGACAGGAAAGGAGGACTACTCCAACTATGCACACACCCCTCGGGAAGAATTTATTGAGCATGTATGTAAAAAATGGCAAGTGAGGCTGCATGCAACAATGCGGTCCCATGTATTTGAAGAAGTGAGGACATGCATCGGAATAGCATTAAAATGTGTGGAGGATGACCGAACTCAAAGGCCTACGATGGCTCAGATTTTGAATGAATTAAGTAACATTGGTATTGTTAAGAGATCACCAGTAGATCGGGTGCAGGAAACAATGTCTACCCAAGTATCCGAAGAAGTGAGGACATGCATCGAAATAGTGTTAAAATGTGTGGAGGATGACAGAACGCAAAGGCCTACAATAGCCCAGATTGTTAATGAACTAAGTAAGATTGGTATTGCTAAAGGTTCATCCATCAGCCAGATTTCCCAGGCTACTTCTTCCAGCCCAGAGCAGACGACACAAGGAGGAGGCCATCAGGTAAACAAGCTGACTGCAACGCCACTAGAAGAAAAGTCGAGATCATGCCCTGGCCAAGCGTGCAAAGAACTGAAGCTAAAGAGGAAAGTAAAACTGAAGTTGAAGAGGAACGTAAAATGA


Protein sequences

Name Description Sequence
barley stem rust resistance protein barley stem rust resistance protein [Hordeum vulgare subsp. vulgare].

MMRRMVMKVALEDRSQQRKALKAVSTLHGIDAIAADLRCGTITVVGVVDPVDVVAKLRRLFANAQIVSVGPAKEEKKDGDKKDGADKKKPVPVPPVYYPFPYYPPPRPRYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRVQETMSTQVSEEVRTCIEIVLKCVEDDRTQRPTIAQIVNELSKIGIAKGSSISQISQATSSSPEQTTQGGGHQVNKLTATPLEEKSRSCPGQACKELKLKRKVKLKLKRNVK

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
94-401 Kinase_like
Protein kinase-like domain

PPVYYPFPYYPPPRPRYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRM

Gene3D: G3DSA:3.30.200.20
112-183 G3DSA:3.30.200.20

FTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPL

ProfileScan: PS50011
IPR000719
124-404 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKI

HMMPfam: PF00069
IPR000719
127-400 Pkinase,Ser-thr
Protein kinase, catalytic domain

ARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

Gene3D: G3DSA:1.10.510.10
184-400 G3DSA:1.10.510.10

VGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSSNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

superfamily: SSF56112
IPR011009
405-735 Kinase_like
Protein kinase-like domain

DIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRVQETMSTQVS

Gene3D: G3DSA:3.30.200.20
417-488 G3DSA:3.30.200.20

KTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKN

HMMPanther: PTHR24420
419-715 PTHR24420,FAMILY NOT NAMED

REFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNI

ProfileScan: PS50011
IPR000719
433-717 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGI

HMMPfam: PF00069
IPR000719
435-711 Pkinase,Ser-thr
Protein kinase, catalytic domain

EKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNE

Gene3D: G3DSA:1.10.510.10
489-712 G3DSA:1.10.510.10

IVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNEL

PatternScan: PS00108
IPR008271
567-579 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHGDLKPGNILL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox