PRGDB00049634 (Rpg1)

From PRG Wiki
Jump to: navigation, search
Rpg1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21929722 (AF509749)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Hordeum vulgare subsp. spontaneum

Comment?

Hordeum vulgare subsp. spontaneum OSU6 barley stem rust resistance protein (Rpg1) gene, complete cds.

DNA Sequence

ATGATGCGAAGGATGGTGATGAAGGTGGCGCTGGAGGACAGGAGCCAGCAGCGGAAGGCGCTCAAAGCAGTCTCCACTCTACATGGTATCGACGCGATTGCCGCGGACTTGCGGTGCGGGACGATCACGGTCGTCGGCGTCGTCGACCCCGTCGACGTCGTGGCCAAGCTGCGAAGGTTGTTTGCCAACGCTCAGATCGTCTCCGTCGGGCCGGCCAAAGAGGAGAAGAAGGACGGCGACAAGAAGGACGGCGCCGACAAGAAGAAGCCCGTACCGGTCCCGCCGGTGTACTATCCCTTTCCCTACTATCCGCCCCCTCGTCCTCGGTACGAGTTTACAGTCGGGTTCTTGAACAGCATCACAGACAATTTCTCCGAGGCGCGCATCATTGTCCGTGGTCGGCATGGAATAGTCTACAAGGGAGTGCTGGACAATGGGCAGTACATTGCTGTGAAGAAGCTTCACCTCATGCCGGGGCTGGACGATGAGGAATTCAAAAACGAGTTTAATAATCTTATGAGGGTCCGACATCAAAATATCATACCGTTGGTTGGTTACTGCCATCACACAAAACAGGTGCTTGTTGAGCACAATGGAAAGCATGTTTCTGCTCGAGTAGAAGAAAGATATTTATGCTCCGAATACTTGGAGGGAGGAAGCCTTGACAAGCATCTTTCTAATGAACCATGCGCACTTGCTTGGTACACATGTTACAAAATAATTAAAGGCATCTGTGATGGTTTACTTTGCCTTCACAAGGGATTCCAAGAGCCTATTTGGCATTTAGAATTAAAACCTACAAAAATTTTGCTGGATAAGGACATGATGCCCAAAATTGGAGGTTTTGGTTTCTCTAGACTCTTTGATTCAATAGAAACCTCCAGCACATCAGAAGTTAGGGGAACAAGTGTATATATGCCACCAGAATACATCAGTAAACGGCTAATCACATCAAGGTTTAATGTATTCAGTCTGGGTGTCATAATCTTGCAAATTATGGCAGGAAAGGAGAGCTATACCAAATGTGTAGACATTCCACCCGAAGAGTTTACTGAGCGTGTATATGGATTCTGGGTAAATAGGATGCCGGGCACAGTATCGAAGCATACTTCCAATGAAGTTAAAACATGCATCGAAATAGCTCTAAAATGCGTGGAGTCCAATCGAGTGAACAGGCCTACTATAAATGAGATCATACAAAGGATGGATAAGATTGATATTGTTGAGTGCTCATCTTTAGGTGATCTATATAAGACAAGGGAGTTTGCATTCGAGTTCTTAGAACATATTACAAATGTTTTTTCTGAGAAGAACATAATTGGTCGTGGTGCATGTGGGGTTATTTACAAGGGAGTGTTGGACAATGGAGAAGAAATTGCTGTTAAGAAACTTCATCAAACGTTGTCTATTGATGATGGGCTATTTAAGAAAGAGGTTAATAATGTAATGAGGGCCGAACATAAAAATATTGTACGGTTAGTTGGCTACTGCCACCATATATCACCAATAATTGTTGAGCACGAAGGAAAACATGTTTCTGCTAGTGTGATAGAAAGAGTGATCTGTTTCGAATACATGCAACGAGGAAGCCTTGACGACCAACTTTCAGCTGAATCCTGCAAACTTGATTGGGACAGATGTTACAAAATAATAAAAGGAATATGTGAGGGGTTACATTACCTTCATAATGCTGTCCCTCCCATTTACCATGGGGACTTAAAACCCGGAAATATTTTGCTGGATAAGGATATGGTGGCAAAGATCGGTGATTTTGGTTTGTCAAGAGTCTTTGATACAACGCAAACCTATATGACAACATCCGGAGTTATTAAAGGAACACCTGGATACATGTCACCAGAATACATCAATGAACATAAGATCAGTCTGAAGTCTGATGTATTTGCTCTCGGGGTCATAATCATAAAAATGATGACAGGAAAGGAGGACTACTCCAACTATGCACACACCCCTCGGGAAGAATTTATTGAGCATGTATGTAAAAAATGGCAAGTGAGGCTGCATGCAACAATGCGGTCCCATGTATTTGAAGAAGTGAGGACATGCATCGGAATAGCATTAAAATGTGTGGAGGATGACCGAACTCAAAGGCCTACGATGGCTCAGATTTTGAATGAATTAAGTAACATTGGTATTGTTAAGAGATCACCAGTAGATCGGGTGCAGGAAACAATGTCTACCCAAGTATCCGAAGAAGTGAGGACATGCATCGAAATAGTGTTAAAATGTGTGGAGGATGACAGAACGCAAAGGCCTACAATAGCCCAGATTGTTAATGAACTAAGTAAGATTGGTATTGCTAAAGGTTCATCCATCAGCCAGATTTCCCAGGCTACTTCTTCCAGCCCAGAGCAGACGACACAAGGAGGAGGCCATCAGGTAAACAAGCTGACTGCAACGCCACTAGAAGAAAAGTCGAGATCATGCCCTGGCCAAGCGTGCAAAGAACTGAAGCTAAAGAGGAAAGTAAAACTGAAGTTGAAGAGGAACGTAAAATGA


Protein sequences

Name Description Sequence
barley stem rust resistance protein barley stem rust resistance protein [Hordeum vulgare subsp. spontaneum].

MMRRMVMKVALEDRSQQRKALKAVSTLHGIDAIAADLRCGTITVVGVVDPVDVVAKLRRLFANAQIVSVGPAKEEKKDGDKKDGADKKKPVPVPPVYYPFPYYPPPRPRYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRVQETMSTQVSEEVRTCIEIVLKCVEDDRTQRPTIAQIVNELSKIGIAKGSSISQISQATSSSPEQTTQGGGHQVNKLTATPLEEKSRSCPGQACKELKLKRKVKLKLKRNVK

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
94-402 Kinase_like
Protein kinase-like domain

PPVYYPFPYYPPPRPRYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRM

HMMPanther: PTHR24420
109-472 PTHR24420,FAMILY NOT NAMED

RYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDD

HMMPanther: PTHR24420:SF754
109-472 PTHR24420:SF754

RYEFTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKIDIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDD

Gene3D: G3DSA:3.30.200.20
112-183 G3DSA:3.30.200.20

FTVGFLNSITDNFSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPL

ProfileScan: PS50011
IPR000719
124-405 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQRMDKI

HMMPfam: PF00069
IPR000719
127-401 Pkinase,Ser-thr
Protein kinase, catalytic domain

ARIIVRGRHGIVYKGVLDNGQYIAVKKLHLMPGLDDEEFKNEFNNLMRVRHQNIIPLVGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

Gene3D: G3DSA:1.10.510.10
184-401 G3DSA:1.10.510.10

VGYCHHTKQVLVEHNGKHVSARVEERYLCSEYLEGGSLDKHLSNEPCALAWYTCYKIIKGICDGLLCLHKGFQEPIWHLELKPTKILLDKDMMPKIGGFGFSRLFDSIETSSTSEVRGTSVYMPPEYISKRLITSRFNVFSLGVIILQIMAGKESYTKCVDIPPEEFTERVYGFWVNRMPGTVSKHTSNEVKTCIEIALKCVESNRVNRPTINEIIQR

superfamily: SSF56112
IPR011009
406-736 Kinase_like
Protein kinase-like domain

DIVECSSLGDLYKTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGIVKRSPVDRVQETMSTQVS

Gene3D: G3DSA:3.30.200.20
418-489 G3DSA:3.30.200.20

KTREFAFEFLEHITNVFSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKN

ProfileScan: PS50011
IPR000719
434-718 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSEKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNELSNIGI

HMMPfam: PF00069
IPR000719
436-712 Pkinase,Ser-thr
Protein kinase, catalytic domain

EKNIIGRGACGVIYKGVLDNGEEIAVKKLHQTLSIDDGLFKKEVNNVMRAEHKNIVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNE

Gene3D: G3DSA:1.10.510.10
490-713 G3DSA:1.10.510.10

IVRLVGYCHHISPIIVEHEGKHVSASVIERVICFEYMQRGSLDDQLSAESCKLDWDRCYKIIKGICEGLHYLHNAVPPIYHGDLKPGNILLDKDMVAKIGDFGLSRVFDTTQTYMTTSGVIKGTPGYMSPEYINEHKISLKSDVFALGVIIIKMMTGKEDYSNYAHTPREEFIEHVCKKWQVRLHATMRSHVFEEVRTCIGIALKCVEDDRTQRPTMAQILNEL

PatternScan: PS00108
IPR008271
568-580 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IYHGDLKPGNILL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox