PRGDB00049638 (receptor-like kinase)

From PRG Wiki
Jump to: navigation, search
receptor-like kinase
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21886729 (AF509744)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare subsp. vulgare Morex receptor-like kinase gene, complete cds.

DNA Sequence

ATGCAGCCTATTATGCTCAACGAACAAGCCATAGTCAACAACCTTACCGAAGATAACGTGACAAGGATGTGGGCTAGCAGAACCACATGGGAGGACGAACAGCTCTACATAGTCCTCGATCAGGGCACTACTGACATCGGTCATCCTGCTAGTCTGGTCGTCAAGAAGTTCCAGAATGAGAACCCAGCACTGCAGGTGGACGCCAATGTCAAGTACCGCTACAAGTCGGAGATGATCCTGTTAGTCAGCAATTCTCACGATAACATCATCAAAGTCATAGACCTCATCGAGAGGGAAGATGCGATCATGCTCGTTTACGGCTATCCGGTGAACGGCAGCCTTCGATCCTGGCTGCACCAACCAATGGATGACCGTCAGCCGCTGAGCTGGCCGCAGAGGAGGCTCATTGCCATTGGCACGGCCAAAGGGCTCCACCACCTGCACTATGGATGCAATAAGCCGATTATCCACCACAACATCAGCTCTGACAACATCTTGCTTGATCAGAATTGCAATGCCGTGATAACCAATTTTGATGATGCATGTATGCACATGGCAGGGCTCGGGCAACCGTTGCCAATCATGGGCGTGCGTCCTGGGAACTTTGGGTTCGCGGCTCCAGAATATGGGAACACGGCAAGCCATATGACGGAGAAGGTAGACACTTACAGCTTTGGTGTGATTTTGCTGGAGCTCGTCACTGGGCGGATGGCCAATGGAGCTGGAGGGGATGGCAACCTGGCGATTTGGGCGCACAAAGTGATTGAGCTAATGGCAAAACAACCGGAGAAGTTCGAGAGTGTTGTGGACAAGCGCATCCCAGATCAAGCGCGGTACATAGACGACATGGCAAGTGTATTCAGGCTCGGCGTCGATTGCACAGTTGTGGATCCGCAGCAAAGGCCGTCCATGCATATGGTTCTCAAACGACTCCACCGTCTCCTTGGGTGTCGCCCATTTCGTGGCCTCCTCACCCGGCTGTGA


Protein sequences

Name Description Sequence
receptor-like kinase receptor-like kinase [Hordeum vulgare subsp. vulgare].

MQPIMLNEQAIVNNLTEDNVTRMWASRTTWEDEQLYIVLDQGTTDIGHPASLVVKKFQNENPALQVDANVKYRYKSEMILLVSNSHDNIIKVIDLIEREDAIMLVYGYPVNGSLRSWLHQPMDDRQPLSWPQRRLIAIGTAKGLHHLHYGCNKPIIHHNISSDNILLDQNCNAVITNFDDACMHMAGLGQPLPIMGVRPGNFGFAAPEYGNTASHMTEKVDTYSFGVILLELVTGRMANGAGGDGNLAIWAHKVIELMAKQPEKFESVVDKRIPDQARYIDDMASVFRLGVDCTVVDPQQRPSMHMVLKRLHRLLGCRPFRGLLTRL

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
9-315 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

QAIVNNLTEDNVTRMWASRTTWEDEQLYIVLDQGTTDIGHPASLVVKKFQNENPALQVDANVKYRYKSEMILLVSNSHDNIIKVIDLIEREDAIMLVYGYPVNGSLRSWLHQPMDDRQPLSWPQRRLIAIGTAKGLHHLHYGCNKPIIHHNISSDNILLDQNCNAVITNFDDACMHMAGLGQPLPIMGVRPGNFGFAAPEYGNTASHMTEKVDTYSFGVILLELVTGRMANGAGGDGNLAIWAHKVIELMAKQPEKFESVVDKRIPDQARYIDDMASVFRLGVDCTVVDPQQRPSMHMVLKRLHRLL

HMMPfam: PF00069
IPR000719
49-310 Pkinase,Ser-thr
Protein kinase, catalytic domain

PASLVVKKFQNENPALQVDANVKYRYKSEMILLVSNSHDNIIKVIDLIEREDAIMLVYGYPVNGSLRSWLHQPMDDRQPLSWPQRRLIAIGTAKGLHHLHYGCNKPIIHHNISSDNILLDQNCNAVITNFDDACMHMAGLGQPLPIMGVRPGNFGFAAPEYGNTASHMTEKVDTYSFGVILLELVTGRMANGAGGDGNLAIWAHKVIELMAKQPEKFESVVDKRIPDQARYIDDMASVFRLGVDCTVVDPQQRPSMHMVLKR

superfamily: SSF56112
IPR011009
53-311 Kinase_like
Protein kinase-like domain

VVKKFQNENPALQVDANVKYRYKSEMILLVSNSHDNIIKVIDLIEREDAIMLVYGYPVNGSLRSWLHQPMDDRQPLSWPQRRLIAIGTAKGLHHLHYGCNKPIIHHNISSDNILLDQNCNAVITNFDDACMHMAGLGQPLPIMGVRPGNFGFAAPEYGNTASHMTEKVDTYSFGVILLELVTGRMANGAGGDGNLAIWAHKVIELMAKQPEKFESVVDKRIPDQARYIDDMASVFRLGVDCTVVDPQQRPSMHMVLKRL

Gene3D: G3DSA:3.30.200.20
53-115 G3DSA:3.30.200.20

VVKKFQNENPALQVDANVKYRYKSEMILLVSNSHDNIIKVIDLIEREDAIMLVYGYPVNGSLR

HMMPanther: PTHR24420
74-313 PTHR24420,FAMILY NOT NAMED

YKSEMILLVSNSHDNIIKVIDLIEREDAIMLVYGYPVNGSLRSWLHQPMDDRQPLSWPQRRLIAIGTAKGLHHLHYGCNKPIIHHNISSDNILLDQNCNAVITNFDDACMHMAGLGQPLPIMGVRPGNFGFAAPEYGNTASHMTEKVDTYSFGVILLELVTGRMANGAGGDGNLAIWAHKVIELMAKQPEKFESVVDKRIPDQARYIDDMASVFRLGVDCTVVDPQQRPSMHMVLKRLHR

HMMPanther: PTHR24420:SF789
74-313 PTHR24420:SF789

YKSEMILLVSNSHDNIIKVIDLIEREDAIMLVYGYPVNGSLRSWLHQPMDDRQPLSWPQRRLIAIGTAKGLHHLHYGCNKPIIHHNISSDNILLDQNCNAVITNFDDACMHMAGLGQPLPIMGVRPGNFGFAAPEYGNTASHMTEKVDTYSFGVILLELVTGRMANGAGGDGNLAIWAHKVIELMAKQPEKFESVVDKRIPDQARYIDDMASVFRLGVDCTVVDPQQRPSMHMVLKRLHR

Gene3D: G3DSA:1.10.510.10
116-311 G3DSA:1.10.510.10

SWLHQPMDDRQPLSWPQRRLIAIGTAKGLHHLHYGCNKPIIHHNISSDNILLDQNCNAVITNFDDACMHMAGLGQPLPIMGVRPGNFGFAAPEYGNTASHMTEKVDTYSFGVILLELVTGRMANGAGGDGNLAIWAHKVIELMAKQPEKFESVVDKRIPDQARYIDDMASVFRLGVDCTVVDPQQRPSMHMVLKRL


List of References

R Brueggeman, N Rostoks, D Kudrna, A Kilian, F Han, J Chen, A Druka, B Steffenson, A Kleinhofs
The barley stem rust-resistance gene Rpg1 is a novel disease-resistance gene with homology to receptor kinases.
Proc. Natl. Acad. Sci. U.S.A.: 2002, 99(14);9328-33
PubMed:12077318 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox