PRGDB00049656 (YR9)

From PRG Wiki
Jump to: navigation, search
YR9
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7248756 (AF220734)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa NBS-LRR-like protein (YR9) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACACTAGCTCAGAAAATATTCAATGATAAAAAATTACAAGGGAGATTTGACCATCGTGCCTGGGTTTGTGTCTCCAAGGAGTATTCTATGGTTTCCCTTTTGACACAAGTTCTTAGTAATATGAAAATTCATTATGAACAAAATGAATCAGTTGGGAACCTTCAAAGCAAACTCAAAGCAGGCATTGCAGACAAGAGTTTTTTCCTTGTGTTGGATGATGTATGGCACTATAAAGCATGGGAAGATTTACTAAGAACTCCACTAAATGCGGCAGCCACAGGAATAATTCTAGTAACTACTCGAGATGAAACTATTGCTCGTGTAATTGGGGTGGACCGGACTCATAGAGTTGATTTGATGTCAGCCGATGTAGGATGGGAGTTACTTTGGAGGAGCATGAACATCAAAGAAGAGAAACAAGTGAAAAATCTACGGGACACGGGTATCGAGATTGTCCGCAAATGTGGTGGCCTCCCCCTCGCCCT


Protein sequences

Name Description Sequence
NBS-LRR-like protein NBS-LRR-like protein [Oryza sativa (japonica cultivar-group)].

GGVGKTTLAQKIFNDKKLQGRFDHRAWVCVSKEYSMVSLLTQVLSNMKIHYEQNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADVGWELLWRSMNIKEEKQVKNLRDTGIEIVRKCGGLPLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-148 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAQKIFNDKKLQGRFDHRAWVCVSKEYSMVSLLTQVLSNMKIHYEQNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADVGWELLWRSMNIKEEKQVK

superfamily: SSF52540
1-168 SSF52540

GGVGKTTLAQKIFNDKKLQGRFDHRAWVCVSKEYSMVSLLTQVLSNMKIHYEQNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADVGWELLWRSMNIKEEKQVKNLRDTGIEIVRKCGGLPLAL

HMMPanther: PTHR23155:SF230
1-148 PTHR23155:SF230,OS11G0674500 PROTEIN

GGVGKTTLAQKIFNDKKLQGRFDHRAWVCVSKEYSMVSLLTQVLSNMKIHYEQNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADVGWELLWRSMNIKEEKQVK

HMMPfam: PF00931
IPR002182
1-168 NB-ARC,NBS
NB-ARC

GGVGKTTLAQKIFNDKKLQGRFDHRAWVCVSKEYSMVSLLTQVLSNMKIHYEQNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARVIGVDRTHRVDLMSADVGWELLWRSMNIKEEKQVKNLRDTGIEIVRKCGGLPLAL

Gene3D: G3DSA:3.40.50.300
2-114 G3DSA:3.40.50.300

GVGKTTLAQKIFNDKKLQGRFDHRAWVCVSKEYSMVSLLTQVLSNMKIHYEQNESVGNLQSKLKAGIADKSFFLVLDDVWHYKAWEDLLRTPLNAAATGIILVTTRDETIARV

FPrintScan: PR00364
IPR000767
67-81 DISEASERSIST
Disease resistance protein

GIADKSFFLVLDDVW

FPrintScan: PR00364
IPR000767
161-168 DISEASERSIST
Disease resistance protein

CGGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox