PRGDB00049657 (YR7)

From PRG Wiki
Jump to: navigation, search
YR7
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7248754 (AF220733)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa NBS-LRR-like protein (YR7) gene, partial cds.

DNA Sequence

GGGGGGGTGGGGAAGACGACTCTAACACAGCTTGTCTACAATGATCCAAGAGTAAAGGAGTACTTCCAGTTACGGGTGTGGCTGTGCGTTTCTGAAAATTTTGACGAAATGAAGCTTACCAAGGAAACCATTGAATCAGTTGCCAGTGGGTTCTCATCGGTCACGACCAACATGAACTTGCTTCAAGAAGATCTCTCAAAAAAGCTGGAAGGTAAAAGATTTCTTCTAGTACTTGATGATGTTTGGAATGAGGACCCTGAAAAATGGGACAGATATCGTTGTGCTCTTGTTAGTGGAAGCAATGGAAGCAGAATTGTAGTAACTACACGGAACAAAAATGTTGGGAAACTAATGGGTGGAATGACTCCTTACTTTCTAAAGCAGTTATCTGAAAATGATTGCTGGAACTTGTTCAGGAGCTATGCATTTGCTGATGGTGACTCCAGTTTGCACCCACATTTAGAAATTATAGGCAAGGAAATTGTGAAGAAGTTGAAAGGCCTCCCCCTCGCCCT


Protein sequences

Name Description Sequence
NBS-LRR-like protein NBS-LRR-like protein [Oryza sativa (japonica cultivar-group)].

GGVGKTTLTQLVYNDPRVKEYFQLRVWLCVSENFDEMKLTKETIESVASGFSSVTTNMNLLQEDLSKKLEGKRFLLVLDDVWNEDPEKWDRYRCALVSGSNGSRIVVTTRNKNVGKLMGGMTPYFLKQLSENDCWNLFRSYAFADGDSSLHPHLEIIGKEIVKKLKGLPLAL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-90 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLTQLVYNDPRVKEYFQLRVWLCVSENFDEMKLTKETIESVASGFSSVTTNMNLLQEDLSKKLEGKRFLLVLDDVWNEDPEKWD

HMMPfam: PF00931
IPR002182
1-172 NB-ARC,NBS
NB-ARC

GGVGKTTLTQLVYNDPRVKEYFQLRVWLCVSENFDEMKLTKETIESVASGFSSVTTNMNLLQEDLSKKLEGKRFLLVLDDVWNEDPEKWDRYRCALVSGSNGSRIVVTTRNKNVGKLMGGMTPYFLKQLSENDCWNLFRSYAFADGDSSLHPHLEIIGKEIVKKLKGLPLAL

HMMPanther: PTHR23155:SF147
1-90 PTHR23155:SF147,OS05G0492600 PROTEIN

GGVGKTTLTQLVYNDPRVKEYFQLRVWLCVSENFDEMKLTKETIESVASGFSSVTTNMNLLQEDLSKKLEGKRFLLVLDDVWNEDPEKWD

superfamily: SSF52540
1-172 SSF52540

GGVGKTTLTQLVYNDPRVKEYFQLRVWLCVSENFDEMKLTKETIESVASGFSSVTTNMNLLQEDLSKKLEGKRFLLVLDDVWNEDPEKWDRYRCALVSGSNGSRIVVTTRNKNVGKLMGGMTPYFLKQLSENDCWNLFRSYAFADGDSSLHPHLEIIGKEIVKKLKGLPLAL

Gene3D: G3DSA:3.40.50.300
2-113 G3DSA:3.40.50.300

GVGKTTLTQLVYNDPRVKEYFQLRVWLCVSENFDEMKLTKETIESVASGFSSVTTNMNLLQEDLSKKLEGKRFLLVLDDVWNEDPEKWDRYRCALVSGSNGSRIVVTTRNKN

FPrintScan: PR00364
IPR000767
68-82 DISEASERSIST
Disease resistance protein

KLEGKRFLLVLDDVW

FPrintScan: PR00364
IPR000767
165-172 DISEASERSIST
Disease resistance protein

LKGLPLAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox