PRGDB00049659 (YR5)

From PRG Wiki
Jump to: navigation, search
YR5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7248750 (AF220731)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa NBS-LRR-like protein (YR5) gene, partial cds.

DNA Sequence

GGGGGGGTGGGAAGACGACATTAGTCACAAATGTTTATGAGCGTGAAAAGGTCAACTTTGCTGCTCATGCATGGATTGTTGTCTCCCAGACCTACAATGTGGAGGCTCTATTAAGAAAGCTCCTTAGAAAGATTGGGTCTACTGAACTGTCACTTGATAGCTTGAACAATATGGATGCACATGACCTGAAAGAAGAAATTAATAAAAAGATTGAAGATAGCAAATGTTTGATTGTGCTGGATGATGTCTGGGACAAAAAAGTGTACTTTCAGATGCAAGATGCATTCCAGAATCTTCAAGCAACTCGAGTCATCATCACAACTCGAGAGAATGATGTTGCAGCCCTTGCTACCTCAACACGCCGTCTCAACCTCCAGCCTTTGAATGGCGCTGATGCATTTGAACTCTTCTGTAGAAGGGCTTTCTATAACAAGGGCCACAAATGCCCCAAGGAGCTAGAGAAGGTTGCTAATTCTATAGTGGATAGGTGTCATGGCCTCCCCTTCGCCCT


Protein sequences

Name Description Sequence
NBS-LRR-like protein NBS-LRR-like protein [Oryza sativa (japonica cultivar-group)].

GGGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPFAL


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-170 NB-ARC,NBS
NB-ARC

GGGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPFAL

HMMPanther: PTHR23155
1-110 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTREN

superfamily: SSF52540
1-170 SSF52540

GGGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTRENDVAALATSTRRLNLQPLNGADAFELFCRRAFYNKGHKCPKELEKVANSIVDRCHGLPFAL

HMMPanther: PTHR23155:SF197
1-110 PTHR23155:SF197,OS11G0227100 PROTEIN

GGGKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTREN

Gene3D: G3DSA:3.40.50.300
3-111 G3DSA:3.40.50.300

GKTTLVTNVYEREKVNFAAHAWIVVSQTYNVEALLRKLLRKIGSTELSLDSLNNMDAHDLKEEINKKIEDSKCLIVLDDVWDKKVYFQMQDAFQNLQATRVIITTREND






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox