PRGDB00049664 (HcrSC9-0B)

From PRG Wiki
Jump to: navigation, search
HcrSC9-0B
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4235645 (AF119041)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum haplotype Southern Cross lipoxygenase gene, partial cds; and Hcr9 gene cluster, complete sequence.

DNA Sequence

ATGGGTTGTGTAAAACTTATATTTTTCATGCTATATGTCTTTCTCTTTCAACTTGTTCCCTCGTCATCCTTACTTCATTTGTGCCCTGAAGATCAAGCTCTTGCTCTTCTACAATTCAAGAACATGTTTACCGTTAATCCTAATGCTTCTGATTATTGTTACGACTATACAGGCGTAGAGATTCAGTCATATCCAAGAACTCTTTCCTGGAACAAGAGCGCGGATTGCTGCTCATGGGATGGCGTTGATTGTGACGAGACGACAGGACAAGTGATTGCGCTTGACCTCTGTTGTAGCAAACTTCGAGGCAAGTTTCATACCAATAGTAGCCTCTTTCAACTCTCCAATCTAAAAAGGCTTGATTTGTCGAATAATAACTTCACTGGATCGCTCATTTCACCTAAATTTGGTGAGTTTTCAAATTTGACGCATCTTGTTTTGTCTGATTCAAGTTTTACAGGTCTTATCCCTTTTGAAATCTCTCACCTTTCTAAACTACACGTTCTTCGTATCAGTGATCTAAATGAGCTTAGTCTAGGGCCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCAACCTTGACTCGGTCAACATCTCTTCCACTATTCCTTCCAATTTCTCCTCTCATTTAACAAATCTATGGCTTCCATACACAGAGTTACGCGGGGTATTGCCTGAAAGAGTTTTCCACCTTTCCGACTTAGAATTCCTTCATTTATCAGGCAATCCCCAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCATGAAGTTATACGTCGATAGTGTGAATATTGCTGATAGGATACCTGAATCATTTAGCCATCTAACTTCACTTCATGAGCTGGACATGGGTTATACTAATCTATCAGGGCCTATTCCTAAACCTTTATGGAATCTCACCAACATAGAGAGTTTGTTCCTTGATGATAACCATCTTGAAGGACCAATTCCCCAGCTCCCGAGATTTGAAAAGCTCAACGACTTATCACTTGGATATAACAACTTGGATGGAGGACTTGAGTTCTTATCCTCTAACAGAAGCTGGACGGAGCTTGAAATATTAGATTTTTCATCCAATTACCTTACTGGTCCAATTCCATCCAACGTAAGTGGACTACGAAATCTACAATTACTCCACTTGTCATCAAACCACTTGAATGGGACTATACCTTCCTGGATATTCTCCCTTCCTTCACTGGTAGTGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGAGTTCAAGTCCAAAACATTAATTACCGTTACCCTAAAACAAAATAAGCTGAAAGGTCCTATTCCGAATTCACTCCTAAACCAGCAGAGCCTATCTTTTCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCATCTATCTGCAATCTGAAAACATTGATATCGTTAGACTTGGGAAGTAACAATTTGGAGGGAACAATCCCACAATGCGTGGGTGAGATGAAAGAAAACCTTTGGAGTTTGGATTTGAGCAACAACAGTTTTAGTGGGACAATCAATACAACTTTTAGTGTTGGAAATTTTTTAAGGGTCATTAGCTTGCACGGGAATAAACTAACCGGTAAAGTCCCACGATCTTTGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATATGTTGAATGACACATTTCCAAACTGGTTGGGATACCTACCTGATTTGAAGATTTTAAGCTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTACGCGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGTATTTTGGGGAATTTGCAAGCCATGAAAAAAATTAATGAGAGTACAAGATTCCCAGAGTATATTTCTGATCCATATGATATTTTTTACAATTATTTGACGACAATTACTACAAAGGGACAAGATTATGATTCTGTTAGAATTTTTACTTCTAACATGATTATCAATCTCTCAAAGAACAGATTCGAAGGTCATATTCCAAGCATTATTGGAGATCTTGTTGGACTTCGTACGTTGAACTTATCTCACAATGCCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAATAAAATCAGCGGAGAAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACACTTCGTACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACTTTGTGGTGTTGATGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTGTCTGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACGCATAATTACTAAGAGAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
SC0A SC0A [Lycopersicon esculentum].

MGCVKLIFFMLYVFLFQLVPSSSLLHLCPEDQALALLQFKNMFTVNPNASDYCYDYTGVEIQSYPRTLSWNKSADCCSWDGVDCDETTGQVIALDLCCSKLRGKFHTNSSLFQLSNLKRLDLSNNNFTGSLISPKFGEFSNLTHLVLSDSSFTGLIPFEISHLSKLHVLRISDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSGNPQLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDDNHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTELEILDFSSNYLTGPIPSNVSGLRNLQLLHLSSNHLNGTIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLITVTLKQNKLKGPIPNSLLNQQSLSFLLLSHNNISGHISSSICNLKTLISLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNSFSGTINTTFSVGNFLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNMLNDTFPNWLGYLPDLKILSLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKKINESTRFPEYISDPYDIFYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGVDDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLERIITKRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-795 PTHR24420,FAMILY NOT NAMED

MGCVKLIFFMLYVFLFQLVPSSSLLHLCPEDQALALLQFKNMFTVNPNASDYCYDYTGVEIQSYPRTLSWNKSADCCSWDGVDCDETTGQVIALDLCCSKLRGKFHTNSSLFQLSNLKRLDLSNNNFTGSLISPKFGEFSNLTHLVLSDSSFTGLIPFEISHLSKLHVLRISDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSGNPQLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDDNHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTELEILDFSSNYLTGPIPSNVSGLRNLQLLHLSSNHLNGTIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLITVTLKQNKLKGPIPNSLLNQQSLSFLLLSHNNISGHISSSICNLKTLISLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNSFSGTINTTFSVGNFLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNMLNDTFPNWLGYLPDLKILSLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKKINESTRFPEYISDPYDIFYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGVDDQVTT

HMMPanther: PTHR24420:SF473
1-795 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLIFFMLYVFLFQLVPSSSLLHLCPEDQALALLQFKNMFTVNPNASDYCYDYTGVEIQSYPRTLSWNKSADCCSWDGVDCDETTGQVIALDLCCSKLRGKFHTNSSLFQLSNLKRLDLSNNNFTGSLISPKFGEFSNLTHLVLSDSSFTGLIPFEISHLSKLHVLRISDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSGNPQLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDDNHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTELEILDFSSNYLTGPIPSNVSGLRNLQLLHLSSNHLNGTIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLITVTLKQNKLKGPIPNSLLNQQSLSFLLLSHNNISGHISSSICNLKTLISLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNSFSGTINTTFSVGNFLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNMLNDTFPNWLGYLPDLKILSLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKKINESTRFPEYISDPYDIFYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLCGVDDQVTT

HMMPfam: PF08263
IPR013210
30-85 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLQFKNMFTVNPNASDYCYDYTGVEIQSYPRTLSWNKSADCCSWDGVDCD

Gene3D: G3DSA:3.80.10.10
70-343 G3DSA:3.80.10.10

WNKSADCCSWDGVDCDETTGQVIALDLCCSKLRGKFHTNSSLFQLSNLKRLDLSNNNFTGSLISPKFGEFSNLTHLVLSDSSFTGLIPFEISHLSKLHVLRISDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSGNPQLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDDNHLEGPIPQLPRFEKLNDLSLG

superfamily: SSF52047
93-422 SSF52047,LRR

ALDLCCSKLRGKFHTNSSLFQLSNLKRLDLSNNNFTGSLISPKFGEFSNLTHLVLSDSSFTGLIPFEISHLSKLHVLRISDLNELSLGPHNFELLLKNLTQLRELNLDSVNISSTIPSNFSSHLTNLWLPYTELRGVLPERVFHLSDLEFLHLSGNPQLTVRFPTTKWNSSASLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDDNHLEGPIPQLPRFEKLNDLSLGYNNLDGGLEFLSSNRSWTELEILDFSSNYLTGPIPSNVSGLRNLQLLHLSSNHLNGTIPSWIFSLPSLVVLDLSNNTFS

HMMPfam: PF00560
IPR001611
116-134 LRR_1
Leucine-rich repeat

NLKRLDLSNNNFTGSLISP

HMMPfam: PF13855
265-324 LRR_8,Leucine rich repeat

SLMKLYVDSVNIADRIPESFSHLTSLHELDMGYTNLSGPIPKPLWNLTNIESLFLDDNHL

Gene3D: G3DSA:3.80.10.10
344-514 G3DSA:3.80.10.10

YNNLDGGLEFLSSNRSWTELEILDFSSNYLTGPIPSNVSGLRNLQLLHLSSNHLNGTIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLITVTLKQNKLKGPIPNSLLNQQSLSFLLLSHNNISGHISSSICNLKTLISLDLGSNNLEGTIPQCVGEMKENLWSLDLSNN

superfamily: SSF52058
359-624 SSF52058,LRR

SWTELEILDFSSNYLTGPIPSNVSGLRNLQLLHLSSNHLNGTIPSWIFSLPSLVVLDLSNNTFSGKIQEFKSKTLITVTLKQNKLKGPIPNSLLNQQSLSFLLLSHNNISGHISSSICNLKTLISLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNSFSGTINTTFSVGNFLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNMLNDTFPNWLGYLPDLKILSLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILG

HMMPfam: PF13855
362-419 LRR_8,Leucine rich repeat

ELEILDFSSNYLTGPIPSNVSGLRNLQLLHLSSNHLNGTIPSWIFSLPSLVVLDLSNN

Gene3D: G3DSA:3.80.10.10
515-631 G3DSA:3.80.10.10

SFSGTINTTFSVGNFLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNMLNDTFPNWLGYLPDLKILSLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKK

HMMPfam: PF00560
IPR001611
603-626 LRR_1
Leucine-rich repeat

RLQILDLSSNGFSGNLPESILGNL

Gene3D: G3DSA:3.80.10.10
675-785 G3DSA:3.80.10.10

INLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSK

superfamily: SSF52058
675-787 SSF52058,LRR

INLSKNRFEGHIPSIIGDLVGLRTLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNTSYQGNDGLRGFPLSKLC

HMMPfam: PF13855
695-754 LRR_8,Leucine rich repeat

GLRTLNLSHNALEGHIPASFQNLSVLESLDLSSNKISGEIPQQLASLTFLEVLNLSHNHL

FPrintScan: PR00019
720-733 LEURICHRPT,Leucine-rich repeat signature

LESLDLSSNKISGE

FPrintScan: PR00019
741-754 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox