PRGDB00049666 (Hcr9-NL0E)

From PRG Wiki
Jump to: navigation, search
Hcr9-NL0E
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4235640 (AF119040)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum haplotype Northern Lights Hcr9 gene cluster, complete sequence.

DNA Sequence

ATGGATTGTGTGAAACTTATATTTTTTATGCTATATCCCTTTCTCTGTCAACTTGCTTTATCCTCATCCTCACCTCATTTGTGCCCCAAAGATGAAGCTCTTGCTCTTCTACAATTCAAGCACATGTTTACCGTTAATCCTAATGCTTCTGATTATTGTTACGACATAACAGACCAAGAGAATATCCAGTCATATCCAAGAACTCTGTCATGGAACAACAGCATAGATTGTTGCTCATGGAATGGAGTTCATTGTGACGAGACGACAGGGCAAGTGATTGAGCTTGATCTCCGTTGCAGCCAACTTCAAGGCAAGTTTCATTCCAATAGCAGCCTCTTTCACCTCTCCAATCTCAAAAGCCTTGATTTGGCTTATAATAATTTTTCTGGATCACTCATTTCACCTAAATTTGGTGAGTTCTCTGGCTTGGCGCATCTTGATTTGTCACATTCAAGTTTTACAGGTCTGATCCCAGCTGAAATCTCTCACCTTTCTAAACTACACATTCTTCGTATAGGTGATCAACATGAGCTTAGTCTTGGGCCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCCACCTTGAATCTGTCAACATCTCTTCCACTATTCCTTCAAATTTCTCTTCTCATTTAACAACTCTACAACTTTCAGACACACAGTTACGTGGGATTTTGCCCGAAAGAGTTCTCCACCTTTCCAACTTAGAAACCCTTATTTTATCATATAACAACTTTCATGGCCAACTTGAGTTCTTATCCTTTAACAGAAGTTGGACCCGACTTGAATTGCTAGATTTTTCGTCCAATTCCCTTACTGGTCCAGTCCCATCCAATGTAAGTGGACTGCAAAACCTACTATGGCTCAGCTTGTCATCAAACCACTTGAATGGGACTATACCTTCCTGGATATTCTCCCTTCCTTCGCTAAAAGTGTTAGACTTGAGCAATAACACTTTCAGAGGAAAAATTCAGGAGTTCAAGTCCAAAACATTAAGTATCGTTACTCTTAAAGAAAATCAGCTGGAAGGTCCAATACCAAATTCACTCCTAAACACGCCAAGCCTAAGAATTCTTCTTCTTTCACACAATAATATCAGTGGACAGATTGCTTCAACTATCTGCAATCTGACAGCACTGAATGTGCTAAATTTGAGAAGTAATAATTTGGAGGGGACAATCCCACAATGTTTGGGTAAGATGAATATTTGTAAATTGGATTTGAGCAACAACAGTCTTAGTGGGACAATTAATACAAATTTTAGTATTGGAAACCAACTCAGGGTCATTAGCTTGCATGGGAATAAGCTAACAGGGAAAGTCCCACGATCTTTGATCAATTGCAAGTACTTGACACTTCTTGATCTAGGTAACAATCAGTTGAATGACACATTTCCAAACTGGTTCGGAGACCTACCTCATTTGCAGATTTTTAGCTTGAGATCAAATAAGTTTCATGGTCCTATTAAATCTTCAGGGAATACAAACTTGTTTGCGCAGCTTCAAATTCTGGATCTGTCATCCAATGGATTTAGTGGTAATTTACCAATAAGTCTTTTTGGGAATTTGCAAGCCATGAAAAAAATTGATGAGAGTACTACCCCACATTATGTGTCTGATCAATATGTTGGTTATTATGATTATTTGACGACAATTACAACAAAGGGACAAGATTATGATTCGGTTCAAATTTTGGATTCTAACATGATTATCGATCTCTCAAAGAACAGGTTTGAAGGTCACATTCCAGGCATTATTGGAGATCTCGTTGGACTTCGTACCTTGAACTTATCTCATAATGTCTTGGAAGGTCATATACCAACATCATTGCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAACAAAATCAGCGGAGAAATTCCGAAGCAGCTTGAATCCCTCACATTTCTTGAAGTCTTGAATCTCTCTCACAATCATCTTGTTGGATGCATTCCCACAGGAAAACAATTTGATTCGTTCGAGAACAGTTCATACCAAGGGAATGATGGGTTACACGGATTTCCACTATCAACACATTGTGGCGGTGATGATCGGGTACCACCGGCAATAACTCCAGCTGAGATAGATCAAGAAGAAGAAGAAGATTCACCAATGATCAGTTGGGAAGCAGTTCTCATGGGTTATGGCTGTGGACTTGTTATTGGACTGTCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGTTGGTTGTGAAATTGGAACACAAAATTACTATGAGAATGAAAAGGCACGAGGAAAGATATTAG


Protein sequences

Name Description Sequence
NL0E NL0E [Lycopersicon esculentum].

MDCVKLIFFMLYPFLCQLALSSSSPHLCPKDEALALLQFKHMFTVNPNASDYCYDITDQENIQSYPRTLSWNNSIDCCSWNGVHCDETTGQVIELDLRCSQLQGKFHSNSSLFHLSNLKSLDLAYNNFSGSLISPKFGEFSGLAHLDLSHSSFTGLIPAEISHLSKLHILRIGDQHELSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSSHLTTLQLSDTQLRGILPERVLHLSNLETLILSYNNFHGQLEFLSFNRSWTRLELLDFSSNSLTGPVPSNVSGLQNLLWLSLSSNHLNGTIPSWIFSLPSLKVLDLSNNTFRGKIQEFKSKTLSIVTLKENQLEGPIPNSLLNTPSLRILLLSHNNISGQIASTICNLTALNVLNLRSNNLEGTIPQCLGKMNICKLDLSNNSLSGTINTNFSIGNQLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWFGDLPHLQIFSLRSNKFHGPIKSSGNTNLFAQLQILDLSSNGFSGNLPISLFGNLQAMKKIDESTTPHYVSDQYVGYYDYLTTITTKGQDYDSVQILDSNMIIDLSKNRFEGHIPGIIGDLVGLRTLNLSHNVLEGHIPTSLQNLSVLESLDLSSNKISGEIPKQLESLTFLEVLNLSHNHLVGCIPTGKQFDSFENSSYQGNDGLHGFPLSTHCGGDDRVPPAITPAEIDQEEEEDSPMISWEAVLMGYGCGLVIGLSVIYIMWSTQYPAWFSRLVVKLEHKITMRMKRHEERY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
4-679 PTHR24420:SF473,SUBFAMILY NOT NAMED

VKLIFFMLYPFLCQLALSSSSPHLCPKDEALALLQFKHMFTVNPNASDYCYDITDQENIQSYPRTLSWNNSIDCCSWNGVHCDETTGQVIELDLRCSQLQGKFHSNSSLFHLSNLKSLDLAYNNFSGSLISPKFGEFSGLAHLDLSHSSFTGLIPAEISHLSKLHILRIGDQHELSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSSHLTTLQLSDTQLRGILPERVLHLSNLETLILSYNNFHGQLEFLSFNRSWTRLELLDFSSNSLTGPVPSNVSGLQNLLWLSLSSNHLNGTIPSWIFSLPSLKVLDLSNNTFRGKIQEFKSKTLSIVTLKENQLEGPIPNSLLNTPSLRILLLSHNNISGQIASTICNLTALNVLNLRSNNLEGTIPQCLGKMNICKLDLSNNSLSGTINTNFSIGNQLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWFGDLPHLQIFSLRSNKFHGPIKSSGNTNLFAQLQILDLSSNGFSGNLPISLFGNLQAMKKIDESTTPHYVSDQYVGYYDYLTTITTKGQDYDSVQILDSNMIIDLSKNRFEGHIPGIIGDLVGLRTLNLSHNVLEGHIPTSLQNLSVLESLDLSSNKISGEIPKQLESLTFLEVLNLSHNHLVGCIPTGKQFDSFENSSYQGNDGL

HMMPanther: PTHR24420
4-679 PTHR24420,FAMILY NOT NAMED

VKLIFFMLYPFLCQLALSSSSPHLCPKDEALALLQFKHMFTVNPNASDYCYDITDQENIQSYPRTLSWNNSIDCCSWNGVHCDETTGQVIELDLRCSQLQGKFHSNSSLFHLSNLKSLDLAYNNFSGSLISPKFGEFSGLAHLDLSHSSFTGLIPAEISHLSKLHILRIGDQHELSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSSHLTTLQLSDTQLRGILPERVLHLSNLETLILSYNNFHGQLEFLSFNRSWTRLELLDFSSNSLTGPVPSNVSGLQNLLWLSLSSNHLNGTIPSWIFSLPSLKVLDLSNNTFRGKIQEFKSKTLSIVTLKENQLEGPIPNSLLNTPSLRILLLSHNNISGQIASTICNLTALNVLNLRSNNLEGTIPQCLGKMNICKLDLSNNSLSGTINTNFSIGNQLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWFGDLPHLQIFSLRSNKFHGPIKSSGNTNLFAQLQILDLSSNGFSGNLPISLFGNLQAMKKIDESTTPHYVSDQYVGYYDYLTTITTKGQDYDSVQILDSNMIIDLSKNRFEGHIPGIIGDLVGLRTLNLSHNVLEGHIPTSLQNLSVLESLDLSSNKISGEIPKQLESLTFLEVLNLSHNHLVGCIPTGKQFDSFENSSYQGNDGL

HMMPfam: PF08263
IPR013210
29-86 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PKDEALALLQFKHMFTVNPNASDYCYDITDQENIQSYPRTLSWNNSIDCCSWNGVHCD

Gene3D: G3DSA:3.80.10.10
71-254 G3DSA:3.80.10.10

WNNSIDCCSWNGVHCDETTGQVIELDLRCSQLQGKFHSNSSLFHLSNLKSLDLAYNNFSGSLISPKFGEFSGLAHLDLSHSSFTGLIPAEISHLSKLHILRIGDQHELSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSSHLTTLQLSDTQLRGILPERVLHLSNLETLILSYNNFHGQ

superfamily: SSF52047
94-372 SSF52047,LRR

ELDLRCSQLQGKFHSNSSLFHLSNLKSLDLAYNNFSGSLISPKFGEFSGLAHLDLSHSSFTGLIPAEISHLSKLHILRIGDQHELSLGPHNFELLLKNLTQLRELHLESVNISSTIPSNFSSHLTTLQLSDTQLRGILPERVLHLSNLETLILSYNNFHGQLEFLSFNRSWTRLELLDFSSNSLTGPVPSNVSGLQNLLWLSLSSNHLNGTIPSWIFSLPSLKVLDLSNNTFRGKIQEFKSKTLSIVTLKENQLEGPIPNSLLNTPSLRILLLSHNNIS

HMMPfam: PF13516
115-130 LRR_6,Leucine Rich repeat

LSNLKSLDLAYNNFSG

ProfileScan: PS51450
IPR001611
117-139 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKSLDLAYNNFSGSLISPKFGE

ProfileScan: PS51450
IPR001611
194-215 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRELHLESVNISSTIPSNFSS

ProfileScan: PS51450
IPR001611
216-237 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTTLQLSDTQLRGILPERVLH

HMMPfam: PF13516
238-254 LRR_6,Leucine Rich repeat

LSNLETLILSYNNFHGQ

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLETLILSYNNFHGQLEFLSFNR

Gene3D: G3DSA:3.80.10.10
255-339 G3DSA:3.80.10.10

LEFLSFNRSWTRLELLDFSSNSLTGPVPSNVSGLQNLLWLSLSSNHLNGTIPSWIFSLPSLKVLDLSNNTFRGKIQEFKSKTLSI

HMMPfam: PF13855
266-323 LRR_8,Leucine rich repeat

RLELLDFSSNSLTGPVPSNVSGLQNLLWLSLSSNHLNGTIPSWIFSLPSLKVLDLSNN

ProfileScan: PS51450
IPR001611
266-287 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLELLDFSSNSLTGPVPSNVSG

superfamily: SSF52058
288-672 SSF52058,LRR

LQNLLWLSLSSNHLNGTIPSWIFSLPSLKVLDLSNNTFRGKIQEFKSKTLSIVTLKENQLEGPIPNSLLNTPSLRILLLSHNNISGQIASTICNLTALNVLNLRSNNLEGTIPQCLGKMNICKLDLSNNSLSGTINTNFSIGNQLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWFGDLPHLQIFSLRSNKFHGPIKSSGNTNLFAQLQILDLSSNGFSGNLPISLFGNLQAMKKIDESTTPHYVSDQYVGYYDYLTTITTKGQDYDSVQILDSNMIIDLSKNRFEGHIPGIIGDLVGLRTLNLSHNVLEGHIPTSLQNLSVLESLDLSSNKISGEIPKQLESLTFLEVLNLSHNHLVGCIPTGKQFDSFENSS

ProfileScan: PS51450
IPR001611
290-312 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLLWLSLSSNHLNGTIPSWIFSL

ProfileScan: PS51450
IPR001611
314-336 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKVLDLSNNTFRGKIQEFKSKT

Gene3D: G3DSA:3.80.10.10
340-418 G3DSA:3.80.10.10

VTLKENQLEGPIPNSLLNTPSLRILLLSHNNISGQIASTICNLTALNVLNLRSNNLEGTIPQCLGKMNICKLDLSNNSL

HMMPfam: PF13516
359-381 LRR_6,Leucine Rich repeat

PSLRILLLSHNNISGQIASTICN

ProfileScan: PS51450
IPR001611
360-382 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRILLLSHNNISGQIASTICNL

ProfileScan: PS51450
IPR001611
384-406 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALNVLNLRSNNLEGTIPQCLGKM

HMMPfam: PF00560
IPR001611
385-404 LRR_1
Leucine-rich repeat

LNVLNLRSNNLEGTIPQCLG

ProfileScan: PS51450
IPR001611
407-428 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NICKLDLSNNSLSGTINTNFSI

Gene3D: G3DSA:3.80.10.10
419-533 G3DSA:3.80.10.10

SGTINTNFSIGNQLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWFGDLPHLQIFSLRSNKFHGPIKSSGNTNLFAQLQILDLSSNGFSGNLPISLFGNLQAMKK

HMMPfam: PF13855
431-489 LRR_8,Leucine rich repeat

QLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWFGDLPHLQIFSLRSNK

ProfileScan: PS51450
IPR001611
431-454 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRVISLHGNKLTGKVPRSLINCK

ProfileScan: PS51450
IPR001611
455-478 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTLLDLGNNQLNDTFPNWFGDLP

ProfileScan: PS51450
IPR001611
505-526 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQILDLSSNGFSGNLPISLFG

HMMPfam: PF00560
IPR001611
505-528 LRR_1
Leucine-rich repeat

QLQILDLSSNGFSGNLPISLFGNL

Gene3D: G3DSA:3.80.10.10
576-685 G3DSA:3.80.10.10

IDLSKNRFEGHIPGIIGDLVGLRTLNLSHNVLEGHIPTSLQNLSVLESLDLSSNKISGEIPKQLESLTFLEVLNLSHNHLVGCIPTGKQFDSFENSSYQGNDGLHGFPLS

HMMPfam: PF13855
596-655 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPTSLQNLSVLESLDLSSNKISGEIPKQLESLTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
596-619 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRTLNLSHNVLEGHIPTSLQNLS

ProfileScan: PS51450
IPR001611
620-643 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLESLDLSSNKISGEIPKQLESLT

FPrintScan: PR00019
621-634 LEURICHRPT,Leucine-rich repeat signature

LESLDLSSNKISGE

FPrintScan: PR00019
642-655 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
644-666 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEVLNLSHNHLVGCIPTGKQFD


List of References

M Parniske, B B Wulff, G Bonnema, C M Thomas, D A Jones, J D Jones
Homologues of the Cf-9 disease resistance gene (Hcr9s) are present at multiple loci on the short arm of tomato chromosome 1.
Mol. Plant Microbe Interact.: 1999, 12(2);93-102
PubMed:9926411 WorldCat.org DOI (P p)

M Parniske, J D Jones
Recombination between diverged clusters of the tomato Cf-9 plant disease resistance gene family.
Proc. Natl. Acad. Sci. U.S.A.: 1999, 96(10);5850-5
PubMed:10318973 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox