PRGDB00049667 (Hcr9-NL0E)

From PRG Wiki
Jump to: navigation, search
Hcr9-NL0E
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4235640 (AF119040)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum haplotype Northern Lights Hcr9 gene cluster, complete sequence.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCGATATGTCTTTCTCTTTCAACTTGTTTCCTCGTCATCCTTACGTCATTTGTGCCCCGAAGATCAAGCTCTTGCTCTTCTACAATTCAAGAACATGTTTACCGTCAATCCTAATGCTTTTCATTATTGTCCTGACATAACAGGCCGAGAGATTCAGTCATATCCAAGAACTCTTTCTTGGAACAAGAGCACAAGTTGCTGCTCATGGGATGGCGTTCATTGTGACGAGACGACAGGACAAGTGATTGCGCTTGACCTCCAACTTCAAGGCAAGTTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTAAAAAGGCTTGATTTGTCTTTTAATGATTTCACTGGATCGCCCATTTCACCTAAATTTGGTGAGTTTTCAGATTTGACGCATCTCGATTTGTCGCATTCTAGTTTTACAGGTCTAATCCCTTTTGAAATCTCTCACCTTTCTAAACTGCACGTTCTTCGTATCCGTGGTCAATATAAACTTAGTCTTGTACCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAGACCTCCAACTTGAATCTATCAACATCTCTTCCACAGTTCCATCAAATTTCTCTTCTCATTTAACGAATCTACGGCTTCCATTCACAGAGTTACGTGGGATATTGCCCGAAAGATTCTTCCACCTTTCCAACTTAGAATCCCTTGATTTATCATTCAATCCCCAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCGTGAATTTATATCTCGCTAGTGTGAATATTGCTGATAGGATACCTGAATCATTTAGCCATCTAACTGCACTTCATGAGTTGTACATGGGTCGTTCTAATCTGTCAGGGCATATTCCTAAACCTCTATGGAATCTCACCAACATAGAGAGTTTGTTCCTTGATTATAACCATCTTGAAGGACCAATTCCCCAGCTCCCGAGATTTCAAAAGCTCAAGGAGTTATCACTTGGAAATAACAATTTGGATGGCGGACTTGAGTTCTTATCCTTTAACACCCAACTTGAATGGATAGATTTATCATCCAATTCCCTAACTGGTCCAAATCCATCCAACGTAAGCGGACTTCAAAACCTAGAATGGCTCTACTTGTCATCAAACAACTTGAATGGGAGTATACCTTCCTGGATATTCTCCCTTCCTTCATTGATAGAGTTAGACTTGAGCAATAACACTTTCAGTGGAAAAATTCAAGACTTCAAGTCCAAAACATTAAGTGTCGTTTCTCTACGACAAAATCAGCTGGAAGGTCCTATTCCGAATTCACTCCTAAACCAGAGCCTATTTTATCTTGTCCTTTCACACAATAATATCAGTGGACATATTTCTTCATCTATCTGCAATCTGAAAAAAATGATATTGTTAGACTTGGGAAGTAACAATTTGGAGGGAACGATCCCACAATGTGTGGGTGAGATGAAAGAAAACCTTTGGAGTTTGGATTTGAGCAACAACAGACTTAGTGGGACAATCAATACAACTTTTAGTATTGGAAACTCTTTAAGGGTCATTAGCTTGCACGGGAATAAGCTAACCGGGAAAGTCCCACGATCTTTGATCAATTGCAAGTATTTGACACTACTTGATCTAGGTAACAATCAGTTGAATGACACATTTCCAAACTGGTTGGGAAACCTATCTCAATTGAAGATTTTAAACTTGAGATCAAATAAGTTGCATGGTCCCATCAAATCTTCAGGGAATACAAACTTGTTTACGCGTCTTCAAATTCTTGATCTATCATCTAATGGATTTAGTGGGAATTTACCCGAAAGTATTTTGGGGAATTTGCAAGCCATGAAAAAAATTGATGAGAGTACAAGAACACCAGAGTATATTTCTGATATTTATTACAATTATTTGACGACAATTACTACAAAGGGACAAGATTATGATTCTGTTAGAATTTTTACTTCTAACATGATTATCAATCTCTCAAAGAACAGATTTGAAGGTCGTATTCCAAGCACTATTGGAGATCTTGTTGGACTTCGTACGTTGAATTTGTCTCATAATGTCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCATTGGATCTCTCATCTAACAAAATCAGCGGAGCAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTTGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGGGAACAGTTCATACCAAGGGAATGATGGGTTACGCGGATTTCCACTCTCAAAACATTGTGGTGGTGATGATCAAGTGACAACTCCAGCTGAGCTAGATCAAGAAGAGGAGGAAGAAGATTCACCAATGATCAGTTGGCAGGGGGTTCTCGTGGGTTACGGTTGTGGACTTGTTATTGGACTATCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCGAGGATGGATTTAAAGTTGGAACACATGATTACTACGAGAATGAAAAAGCACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
NL0C NL0C [Lycopersicon esculentum].

MGCVKLVFFMRYVFLFQLVSSSSLRHLCPEDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSPISPKFGEFSDLTHLDLSHSSFTGLIPFEISHLSKLHVLRIRGQYKLSLVPHNFELLLKNLTQLRDLQLESINISSTVPSNFSSHLTNLRLPFTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLASVNIADRIPESFSHLTALHELYMGRSNLSGHIPKPLWNLTNIESLFLDYNHLEGPIPQLPRFQKLKELSLGNNNLDGGLEFLSFNTQLEWIDLSSNSLTGPNPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNNTFSGKIQDFKSKTLSVVSLRQNQLEGPIPNSLLNQSLFYLVLSHNNISGHISSSICNLKKMILLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNRLSGTINTTFSIGNSLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGNLSQLKILNLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDIYYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGRIPSTIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNSSYQGNDGLRGFPLSKHCGGDDQVTTPAELDQEEEEEDSPMISWQGVLVGYGCGLVIGLSVIYIMWSTQYPAWFSRMDLKLEHMITTRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-768 PTHR24420,FAMILY NOT NAMED

MGCVKLVFFMRYVFLFQLVSSSSLRHLCPEDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSPISPKFGEFSDLTHLDLSHSSFTGLIPFEISHLSKLHVLRIRGQYKLSLVPHNFELLLKNLTQLRDLQLESINISSTVPSNFSSHLTNLRLPFTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLASVNIADRIPESFSHLTALHELYMGRSNLSGHIPKPLWNLTNIESLFLDYNHLEGPIPQLPRFQKLKELSLGNNNLDGGLEFLSFNTQLEWIDLSSNSLTGPNPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNNTFSGKIQDFKSKTLSVVSLRQNQLEGPIPNSLLNQSLFYLVLSHNNISGHISSSICNLKKMILLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNRLSGTINTTFSIGNSLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGNLSQLKILNLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDIYYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGRIPSTIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNSSYQGNDGL

HMMPanther: PTHR24420:SF473
1-768 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLVFFMRYVFLFQLVSSSSLRHLCPEDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCDETTGQVIALDLQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSPISPKFGEFSDLTHLDLSHSSFTGLIPFEISHLSKLHVLRIRGQYKLSLVPHNFELLLKNLTQLRDLQLESINISSTVPSNFSSHLTNLRLPFTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLASVNIADRIPESFSHLTALHELYMGRSNLSGHIPKPLWNLTNIESLFLDYNHLEGPIPQLPRFQKLKELSLGNNNLDGGLEFLSFNTQLEWIDLSSNSLTGPNPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNNTFSGKIQDFKSKTLSVVSLRQNQLEGPIPNSLLNQSLFYLVLSHNNISGHISSSICNLKKMILLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNRLSGTINTTFSIGNSLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGNLSQLKILNLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDIYYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGRIPSTIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNSSYQGNDGL

HMMPfam: PF08263
IPR013210
30-85 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EDQALALLQFKNMFTVNPNAFHYCPDITGREIQSYPRTLSWNKSTSCCSWDGVHCD

Gene3D: G3DSA:3.80.10.10
70-348 G3DSA:3.80.10.10

WNKSTSCCSWDGVHCDETTGQVIALDLQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSPISPKFGEFSDLTHLDLSHSSFTGLIPFEISHLSKLHVLRIRGQYKLSLVPHNFELLLKNLTQLRDLQLESINISSTVPSNFSSHLTNLRLPFTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLASVNIADRIPESFSHLTALHELYMGRSNLSGHIPKPLWNLTNIESLFLDYNHLEGPIPQLPRFQKLKELSLGNNNLDGGL

superfamily: SSF52047
95-416 SSF52047,LRR

DLQLQGKFHSNSSLFQLSNLKRLDLSFNDFTGSPISPKFGEFSDLTHLDLSHSSFTGLIPFEISHLSKLHVLRIRGQYKLSLVPHNFELLLKNLTQLRDLQLESINISSTVPSNFSSHLTNLRLPFTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLASVNIADRIPESFSHLTALHELYMGRSNLSGHIPKPLWNLTNIESLFLDYNHLEGPIPQLPRFQKLKELSLGNNNLDGGLEFLSFNTQLEWIDLSSNSLTGPNPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNNTFS

HMMPfam: PF13516
111-125 LRR_6,Leucine Rich repeat

LSNLKRLDLSFNDFT

ProfileScan: PS51450
IPR001611
113-134 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKRLDLSFNDFTGSPISPKFG

ProfileScan: PS51450
IPR001611
138-159 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLTHLDLSHSSFTGLIPFEISH

ProfileScan: PS51450
IPR001611
236-245 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLESLDLSFN

HMMPfam: PF00560
IPR001611
236-284 LRR_1
Leucine-rich repeat

NLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLASVNIADRIPESFSHL

ProfileScan: PS51450
IPR001611
310-332 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NIESLFLDYNHLEGPIPQLPRFQ

ProfileScan: PS51450
IPR001611
333-352 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKELSLGNNNLDGGLEFLS

Gene3D: G3DSA:3.80.10.10
354-588 G3DSA:3.80.10.10

NTQLEWIDLSSNSLTGPNPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNNTFSGKIQDFKSKTLSVVSLRQNQLEGPIPNSLLNQSLFYLVLSHNNISGHISSSICNLKKMILLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNRLSGTINTTFSIGNSLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGNLSQLKILNLRSNKLHGPIKSS

ProfileScan: PS51450
IPR001611
356-379 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLEWIDLSSNSLTGPNPSNVSGLQ

HMMPfam: PF13855
356-413 LRR_8,Leucine rich repeat

QLEWIDLSSNSLTGPNPSNVSGLQNLEWLYLSSNNLNGSIPSWIFSLPSLIELDLSNN

ProfileScan: PS51450
IPR001611
380-402 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEWLYLSSNNLNGSIPSWIFSL

ProfileScan: PS51450
IPR001611
404-426 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIELDLSNNTFSGKIQDFKSKT

superfamily: SSF52058
448-765 SSF52058,LRR

QSLFYLVLSHNNISGHISSSICNLKKMILLDLGSNNLEGTIPQCVGEMKENLWSLDLSNNRLSGTINTTFSIGNSLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQLNDTFPNWLGNLSQLKILNLRSNKLHGPIKSSGNTNLFTRLQILDLSSNGFSGNLPESILGNLQAMKKIDESTRTPEYISDIYYNYLTTITTKGQDYDSVRIFTSNMIINLSKNRFEGRIPSTIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFGNSSYQGN

ProfileScan: PS51450
IPR001611
449-471 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLFYLVLSHNNISGHISSSICNL

HMMPfam: PF00560
IPR001611
450-471 LRR_1
Leucine-rich repeat

LFYLVLSHNNISGHISSSICNL

HMMPfam: PF13855
498-557 LRR_8,Leucine rich repeat

NLWSLDLSNNRLSGTINTTFSIGNSLRVISLHGNKLTGKVPRSLINCKYLTLLDLGNNQL

ProfileScan: PS51450
IPR001611
498-519 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLWSLDLSNNRLSGTINTTFSI

FPrintScan: PR00019
499-512 LEURICHRPT,Leucine-rich repeat signature

LWSLDLSNNRLSGT

ProfileScan: PS51450
IPR001611
522-545 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVISLHGNKLTGKVPRSLINCK

ProfileScan: PS51450
IPR001611
546-569 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTLLDLGNNQLNDTFPNWLGNLS

ProfileScan: PS51450
IPR001611
570-591 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKILNLRSNKLHGPIKSSGNT

HMMPfam: PF00560
IPR001611
596-619 LRR_1
Leucine-rich repeat

RLQILDLSSNGFSGNLPESILGNL

ProfileScan: PS51450
IPR001611
596-617 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQILDLSSNGFSGNLPESILG

Gene3D: G3DSA:3.80.10.10
664-749 G3DSA:3.80.10.10

IINLSKNRFEGRIPSTIGDLVGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIP

ProfileScan: PS51450
IPR001611
685-708 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRTLNLSHNVLEGHIPASFQNLS

HMMPfam: PF13855
685-744 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
709-732 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLESLDLSSNKISGAIPQQLASLT

FPrintScan: PR00019
731-744 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL

ProfileScan: PS51450
IPR001611
733-755 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEVLNLSHNHLVGCIPKGKQFD


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox