PRGDB00049668 (Hcr9-NL0E)

From PRG Wiki
Jump to: navigation, search
Hcr9-NL0E
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 4235640 (AF119040)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum haplotype Northern Lights Hcr9 gene cluster, complete sequence.

DNA Sequence

ATGGGTTGTGTAAAACTTGTGTTTTTCATGCTATATTCCTTTCTCTGTCAACTTGCTTTCTCCTCATCCTCATCTCATTTGTGCCCGAAATATCAAGCTCTTGCTCTTCTACAGTTCAAGAACATGTTTACCGTTAATCCTGATGCTTCTTATTATTGTGAGTTTTCTCATCCAAAAACTCGTTCCTGGAACAAGAGCACAGATTGTTGCTCATGGGATGGAGTTCATTGTGACAATACAACAGGACAAGTAATTGAGCTTGATCTCCGTTGCAGCCAACTTCAAGGCAAGCTTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGACTTGATTTGTCTTATAATGATTTCACTGGATCGCCCATTTCACCTAAATTTGGTGAGTTTTCAAATTTGACGCATCTTGATTTGTTTGATTCTAATTTTACGGGTATAATCCCTTCCGAAATTTCTCATCTTTCTAAACTATACGTTCTGCGTACCTCGACTGATTATCCATATGGGCTTAGTCTTGGGCCTCACAATTTTGAACTGCTCCTTAAGAACTTGACCCAATTAAGAGAGCTCAACCTTTACGATGTGAACCTCTCTTCCACCATTCCTTCCAATTTCTCTTCTCATTTAACAAATCTACGGCTTGCATACACAGAGTTACGTGGGATATTGCCCGAAAGATTCTTCCACCTTTCCAACTTAGAATCCCTTGATTTATCATTCAATCCCCAGCTCACGGTTAGGTTTCCCACAACCAAATGGAATAGCAGTGCATCACTCGTGAATTTATATCTCGCTGGTGTGAATATTGCTGATAGGATACCTGAATCATTTAGCCATCTAACTGCACTTCATAAGCTGCACATGGGTTATACTAATCTGTCAGGGCCCATTCCTAAACCTCTATGGAATCTCACCCACATAGAGAGTTTGTTCCTTGATTATAACCATCTTGAAGGACCAATTTCCCATTTCACGATATTTGAAAAGCTCAAGAGTTTATCACTTGGAAATAACAACTTTGATGGCCGTCTTGAGTTCTTATCCTTTAACAGAAGCTGGATGAAGCTTGAAAGGCTAGATTTTTCATCCAATTTCCTAACTGGTCCAATTCCATCCAATGTAAGTGGACTGCAAAACCTACAACAACTCATCTTGTCGTCAAACCACTTGAATGGGACTATACCTTCCTGGATATTCTCCCTTCCTTCACTGACAGTTTTAAACTTGAGTGATAACACTTTGAGTGGAAAAATTCAGGAGTTCAAGTCCAAAACATTATATTTCGTTAGTCTAGAACAAAATAAGCTGGAAGGTCCAATTCCAAGGTCACTCCTAAACCAGCAGTTCCTACAAGCTCTTCTCCTTTCACACAATAATATCAGTGGACATATTTCTTCAGCTATCTGCAATCTGAAAACATTCATACTACTAAATTTGAAAAGTAATAATTTGGAGGGAACAATCCCACAATGTTTGGGTGAGATGAGTGAACTTCAAGTTTTGGATTTAAGCAACAATAGTCTTAGTGGAACAATGAATACAACTTTTAGTATTGGAAACCCACTCCACATCATTAAATTGGACTGGAATAAGCTACAGGGGAAAGTCCCACCATCTTTGATCAATTGTAAGAAATTGGAACTTCTAGATTTAAGTAACAATGAGTTGAATGACACGTTTCCAAAATGGTTAGGAGACCTACCTAATTTGCAGGTTTTAAACTTTAGATCAAATAAGTTGTATGGCCCTATAAGGACTAACAACTTGTTTGCTAAAATTCGAGTCGTAGATCTCTCATCCAATGGATTTAGTGGAGATTTACCAGTGAGCTTTTTTGAGAATTTTGAAGCCATGAAAATAAATGGTGAGAACAATGGAACCCGAAAGTATGTAGCAGATCTGTATTCTGATTATTACAAAAATTATTTGATAGTGACAACGAAGGGACTGGATCAGGAACTTTCTCGAGTTTTGACTACACAAATAATTATTGATCTCTCAAAGAACAAATTTGAAGGTCATATTCCAAACATTATTGGAGATCTCATTGGACTTCGTACCTTGAACCTATCTCATAATGTCTTGGAAGGTCATATACCGGCATCATTTCAAAATTTATCAGTACTCGAATCATTAGATCTCTCATCTAACAAAATCAGCGGAGCAATTCCGCAGCAGCTTGCATCCCTCACATTCCTTGAAGTCTTAAATCTCTCTCACAATCATCTCGTTGGATGCATCCCCAAAGGAAAACAATTTGATTCGTTCGAGAACAGTTCATACCTTGGAAATGATGGATTACGAGGATTGCCACCCTCAAGAGATTGTGGCCGTGATGATCAAGTAACAACTCCAGCTGAGCTAGATCAAGAAGAAGATTCACCAATGATCAGTTGGCAAGCAGTTCTCATGGGTTACGGTTGTGAACTTGTTATTGGACTATCCGTAATATACATAATGTGGTCAACTCAATATCCAGCATGGTTTTCCAGGATGGATGTAAAATTGGAACACATCATTAGTAAAAGAATGAAAAAACACAAGAAAAGATATTAG


Protein sequences

Name Description Sequence
NL0D NL0D [Lycopersicon esculentum].

MGCVKLVFFMLYSFLCQLAFSSSSSHLCPKYQALALLQFKNMFTVNPDASYYCEFSHPKTRSWNKSTDCCSWDGVHCDNTTGQVIELDLRCSQLQGKLHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSNLTHLDLFDSNFTGIIPSEISHLSKLYVLRTSTDYPYGLSLGPHNFELLLKNLTQLRELNLYDVNLSSTIPSNFSSHLTNLRLAYTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLAGVNIADRIPESFSHLTALHKLHMGYTNLSGPIPKPLWNLTHIESLFLDYNHLEGPISHFTIFEKLKSLSLGNNNFDGRLEFLSFNRSWMKLERLDFSSNFLTGPIPSNVSGLQNLQQLILSSNHLNGTIPSWIFSLPSLTVLNLSDNTLSGKIQEFKSKTLYFVSLEQNKLEGPIPRSLLNQQFLQALLLSHNNISGHISSAICNLKTFILLNLKSNNLEGTIPQCLGEMSELQVLDLSNNSLSGTMNTTFSIGNPLHIIKLDWNKLQGKVPPSLINCKKLELLDLSNNELNDTFPKWLGDLPNLQVLNFRSNKLYGPIRTNNLFAKIRVVDLSSNGFSGDLPVSFFENFEAMKINGENNGTRKYVADLYSDYYKNYLIVTTKGLDQELSRVLTTQIIIDLSKNKFEGHIPNIIGDLIGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFENSSYLGNDGLRGLPPSRDCGRDDQVTTPAELDQEEDSPMISWQAVLMGYGCELVIGLSVIYIMWSTQYPAWFSRMDVKLEHIISKRMKKHKKRY


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-778 PTHR24420:SF473,SUBFAMILY NOT NAMED

MGCVKLVFFMLYSFLCQLAFSSSSSHLCPKYQALALLQFKNMFTVNPDASYYCEFSHPKTRSWNKSTDCCSWDGVHCDNTTGQVIELDLRCSQLQGKLHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSNLTHLDLFDSNFTGIIPSEISHLSKLYVLRTSTDYPYGLSLGPHNFELLLKNLTQLRELNLYDVNLSSTIPSNFSSHLTNLRLAYTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLAGVNIADRIPESFSHLTALHKLHMGYTNLSGPIPKPLWNLTHIESLFLDYNHLEGPISHFTIFEKLKSLSLGNNNFDGRLEFLSFNRSWMKLERLDFSSNFLTGPIPSNVSGLQNLQQLILSSNHLNGTIPSWIFSLPSLTVLNLSDNTLSGKIQEFKSKTLYFVSLEQNKLEGPIPRSLLNQQFLQALLLSHNNISGHISSAICNLKTFILLNLKSNNLEGTIPQCLGEMSELQVLDLSNNSLSGTMNTTFSIGNPLHIIKLDWNKLQGKVPPSLINCKKLELLDLSNNELNDTFPKWLGDLPNLQVLNFRSNKLYGPIRTNNLFAKIRVVDLSSNGFSGDLPVSFFENFEAMKINGENNGTRKYVADLYSDYYKNYLIVTTKGLDQELSRVLTTQIIIDLSKNKFEGHIPNIIGDLIGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFENSSYLGNDGLRGLPPSRDC

HMMPanther: PTHR24420
1-778 PTHR24420,FAMILY NOT NAMED

MGCVKLVFFMLYSFLCQLAFSSSSSHLCPKYQALALLQFKNMFTVNPDASYYCEFSHPKTRSWNKSTDCCSWDGVHCDNTTGQVIELDLRCSQLQGKLHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSNLTHLDLFDSNFTGIIPSEISHLSKLYVLRTSTDYPYGLSLGPHNFELLLKNLTQLRELNLYDVNLSSTIPSNFSSHLTNLRLAYTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLAGVNIADRIPESFSHLTALHKLHMGYTNLSGPIPKPLWNLTHIESLFLDYNHLEGPISHFTIFEKLKSLSLGNNNFDGRLEFLSFNRSWMKLERLDFSSNFLTGPIPSNVSGLQNLQQLILSSNHLNGTIPSWIFSLPSLTVLNLSDNTLSGKIQEFKSKTLYFVSLEQNKLEGPIPRSLLNQQFLQALLLSHNNISGHISSAICNLKTFILLNLKSNNLEGTIPQCLGEMSELQVLDLSNNSLSGTMNTTFSIGNPLHIIKLDWNKLQGKVPPSLINCKKLELLDLSNNELNDTFPKWLGDLPNLQVLNFRSNKLYGPIRTNNLFAKIRVVDLSSNGFSGDLPVSFFENFEAMKINGENNGTRKYVADLYSDYYKNYLIVTTKGLDQELSRVLTTQIIIDLSKNKFEGHIPNIIGDLIGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFENSSYLGNDGLRGLPPSRDC

HMMPfam: PF08263
IPR013210
29-78 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PKYQALALLQFKNMFTVNPDASYYCEFSHPKTRSWNKSTDCCSWDGVHCD

Gene3D: G3DSA:3.80.10.10
60-347 G3DSA:3.80.10.10

TRSWNKSTDCCSWDGVHCDNTTGQVIELDLRCSQLQGKLHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSNLTHLDLFDSNFTGIIPSEISHLSKLYVLRTSTDYPYGLSLGPHNFELLLKNLTQLRELNLYDVNLSSTIPSNFSSHLTNLRLAYTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLAGVNIADRIPESFSHLTALHKLHMGYTNLSGPIPKPLWNLTHIESLFLDYNHLEGPISHFTIFEKLKSLSLGNNNFDGRLE

superfamily: SSF52047
86-417 SSF52047,LRR

ELDLRCSQLQGKLHSNSSLFQLSNLKRLDLSYNDFTGSPISPKFGEFSNLTHLDLFDSNFTGIIPSEISHLSKLYVLRTSTDYPYGLSLGPHNFELLLKNLTQLRELNLYDVNLSSTIPSNFSSHLTNLRLAYTELRGILPERFFHLSNLESLDLSFNPQLTVRFPTTKWNSSASLVNLYLAGVNIADRIPESFSHLTALHKLHMGYTNLSGPIPKPLWNLTHIESLFLDYNHLEGPISHFTIFEKLKSLSLGNNNFDGRLEFLSFNRSWMKLERLDFSSNFLTGPIPSNVSGLQNLQQLILSSNHLNGTIPSWIFSLPSLTVLNLSDNTLS

HMMPfam: PF13516
107-121 LRR_6,Leucine Rich repeat

LSNLKRLDLSYNDFT

HMMPfam: PF00560
IPR001611
234-251 LRR_1
Leucine-rich repeat

NLESLDLSFNPQLTVRFP

superfamily: SSF52058
353-767 SSF52058,LRR

RSWMKLERLDFSSNFLTGPIPSNVSGLQNLQQLILSSNHLNGTIPSWIFSLPSLTVLNLSDNTLSGKIQEFKSKTLYFVSLEQNKLEGPIPRSLLNQQFLQALLLSHNNISGHISSAICNLKTFILLNLKSNNLEGTIPQCLGEMSELQVLDLSNNSLSGTMNTTFSIGNPLHIIKLDWNKLQGKVPPSLINCKKLELLDLSNNELNDTFPKWLGDLPNLQVLNFRSNKLYGPIRTNNLFAKIRVVDLSSNGFSGDLPVSFFENFEAMKINGENNGTRKYVADLYSDYYKNYLIVTTKGLDQELSRVLTTQIIIDLSKNKFEGHIPNIIGDLIGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFENSSYLGND

HMMPfam: PF13855
357-415 LRR_8,Leucine rich repeat

KLERLDFSSNFLTGPIPSNVSGLQNLQQLILSSNHLNGTIPSWIFSLPSLTVLNLSDNT

Gene3D: G3DSA:3.80.10.10
357-610 G3DSA:3.80.10.10

KLERLDFSSNFLTGPIPSNVSGLQNLQQLILSSNHLNGTIPSWIFSLPSLTVLNLSDNTLSGKIQEFKSKTLYFVSLEQNKLEGPIPRSLLNQQFLQALLLSHNNISGHISSAICNLKTFILLNLKSNNLEGTIPQCLGEMSELQVLDLSNNSLSGTMNTTFSIGNPLHIIKLDWNKLQGKVPPSLINCKKLELLDLSNNELNDTFPKWLGDLPNLQVLNFRSNKLYGPIRTNNLFAKIRVVDLSSNGFSGDLP

FPrintScan: PR00019
500-513 LEURICHRPT,Leucine-rich repeat signature

LQVLDLSNNSLSGT

HMMPfam: PF00560
IPR001611
500-513 LRR_1
Leucine-rich repeat

LQVLDLSNNSLSGT

HMMPfam: PF13855
524-582 LRR_8,Leucine rich repeat

LHIIKLDWNKLQGKVPPSLINCKKLELLDLSNNELNDTFPKWLGDLPNLQVLNFRSNKL

HMMPfam: PF00560
IPR001611
595-616 LRR_1
Leucine-rich repeat

IRVVDLSSNGFSGDLPVSFFEN

Gene3D: G3DSA:3.80.10.10
666-774 G3DSA:3.80.10.10

IDLSKNKFEGHIPNIIGDLIGLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHLVGCIPKGKQFDSFENSSYLGNDGLRGLPP

HMMPfam: PF13855
686-745 LRR_8,Leucine rich repeat

GLRTLNLSHNVLEGHIPASFQNLSVLESLDLSSNKISGAIPQQLASLTFLEVLNLSHNHL

FPrintScan: PR00019
732-745 LEURICHRPT,Leucine-rich repeat signature

LTFLEVLNLSHNHL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox