PRGDB00049670 (Hcr2-5B)

From PRG Wiki
Jump to: navigation, search
Hcr2-5B
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3894390 (AF053997)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum var. cerasiforme

Comment?

Lycopersicon esculentum Hcr2-5B (Hcr2-5B) gene, complete cds.

DNA Sequence

ATGATGATGGTTACTAGCAAAGTATTCTCTTCACTTCAGTTTTTCACTGTTTTCTACCTCTTTACAGTTGCATTTGCTTCGACTGAGGAGGCAACTGCCCTCTTGAAATGGAAAGCAACTTTCAAGAACCAGAATAATTCCTTTTTGGCTTCATGGACGACAAGTTCTAATGCATGCAAGGACTGGTATGGAGTTGTATGCTTGAATGGTAGGGTAAACACGTTGAATATTACAAATGCCAGTGTCATTGGTACACTTTATGCTTTTCCATTTTCATCCCTCCCTTTTCTCGAGAATCTTGATCTTAGCAACAACAATATCTCTGGTACCATTCCACCTGAGATTGGTAATCTCACAAATCTTGTCTATCTTGACTTGAACACCAATCAGATTTCAGGAACAATTCCACCACAAATCGGTTCACTAGCCAAGCTTCAGATCATCCGCATATTTAACAATCATTTAAATGGCTTTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGGTATCAACTTTCTTAGTGGTTCTATTCCTGCTTCATTGGGCAATATGACCAACTTGTCTTTTTTATTTCTTTATGAAAATCAGCTTTCTGGCTTTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTAAGCTATCTTTGGATATCAACTTTCTTAGTGGTTCCATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTTTTTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACTTACCTAGATTTGAAAGAGAATGCTCTTAATGGCTCTATTCCTGCTTCATTGGGGAATCTGAACAACTTGTCTAGGTTGTATCTTTACAATAATCAGCTTTCTGGCTCTATTCCTGAAGAAATAGGTTACTTGAGTTCTCTTACTAATCTATATTTGGGTAATAACTCTCTTATTGGACTTATTCCTGCTTCATTCGGCAATATGAGAAATCTGCAAGCTCTGTTTCTCAATGATAACAATCTCATTGGGGAAATTCCTTCATTTGTGTGCAATTTAACATCACTAGAACTGTTGTATATGCCGAGAAACAATTTGAAGGGAAAAGTTCCGCAATGTTTGGGTAATATCAGTGACCTTCTGGTTTTGTCAATGTCATCTAATAGTTTCAGTGGAGAGCTCCCTTCATCTATTTCCAATTTAACATCACTAAAAATACTTGATTTTGGCAGAAACAATCTGGAGGGAGCAATACCACAATGTTTTGGCAATATTAGTAGCCTCCAGGTTTTTGATATGCAGAATAACAAACTTTCTGGGACTCTTCCAACAAATTTTAGCATTGGATGTTCACTGATAAGTCTCAACTTGCATGGCAATGAACTAGAGGATGAAATCCCTTGGTCTTTGGACAATTGCAAAAAGCTGCAAGTTCTTGATTTAGGAGACAATCAACTCAACGACACATTTCCCATGTGGTTGGGAACTTTGCCAGAGCTGAGAGTTTTAAGGTTGACATCGAATAAATTGCATGGACCTATAAGATCATCAGGGGCTGAAATCATGTTTCCTGATCTTCGAATCATAGATCTCTCTCGCAATGCATTCTCGCAAGACTTACCAACAAGTCTATTTGAACATTTGAAAGGGATGAGGACAGTTGATAAAACAATGGAGGAACCAAGCTATGAAATATATTACGATTCGGTTGTAGTTGTGACAAAGGGATTGGAGCTTGAAATTGTGAGAATTCTGTCTTTGTACACAGTTATCGATCTTTCAAGCAACAAATTTGAAGGACATATTCCTTCTGTCCTGGGAGATCTCATTGCGATCCGTGTACTTAATGTATCTCATAATGCATTGCAAGGCTATATACCATCATCACTTGGAAGTTTATCTATACTGGAATCACTAGACCTTTCGTTTAACCAACTTTCGGGAGAGATACCACAACAACTTGCTTCTCTTACGTTTCTTGAATTCTTAAATCTCTCCCACAATTATCTCCAAGGATGCATCCCTCAAGGACCTCAATTCCGTACCTTTGAGAGCAATTCATATATAGGTAATGATGGATTACGTGGATATCCAGTTTCAAAAGGTTGTGGCAAAGATCCTGTGTCAGAGAAAAACTATACAGTGTCTGCGCTAGAAGATCAAGAAAGCAATTCTAAATTTTTCAATGATTTTTGGAAAGCAGCTCTGATGGGCTATGGAAGTGGACTGTGTTTTGGCATATCCATAATATATTTCTTGATCTCGACTGGAAATCTAAGATGGCTTGCAAGAATCATTGAAGAACTGGAACACAAAATTATTATGCAAAGGAGGAAGAAGCAGCGAGGTCAAAGAAATTACAGAAGAAGAAATAATCGCTTCTAG


Protein sequences

Name Description Sequence
Hcr2-5B Hcr2-5B [Lycopersicon esculentum].

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLKENALNGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLIGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYEIYYDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQGPQFRTFESNSYIGNDGLRGYPVSKGCGKDPVSEKNYTVSALEDQESNSKFFNDFWKAALMGYGSGLCFGISIIYFLISTGNLRWLARIIEELEHKIIMQRRKKQRGQRNYRRRNNRF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-677 PTHR24420:SF474,SUBFAMILY NOT NAMED

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLKENALNGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLIGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYEIYYDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQG

HMMPanther: PTHR24420
1-677 PTHR24420,FAMILY NOT NAMED

MMMVTSKVFSSLQFFTVFYLFTVAFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLKENALNGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTNLYLGNNSLIGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYEIYYDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQG

superfamily: SSF52058
24-301 SSF52058,LRR

AFASTEEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLKENALNGSIPASLGNLNNLSRLYLYNNQLSG

Gene3D: G3DSA:3.80.10.10
29-320 G3DSA:3.80.10.10

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVCLNGRVNTLNITNASVIGTLYAFPFSSLPFLENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQISGTIPPQIGSLAKLQIIRIFNNHLNGFIPEEIGYLRSLTKLSLGINFLSGSIPASLGNMTNLSFLFLYENQLSGFIPEEIGYLRSLTKLSLDINFLSGSIPASLGNLNNLSFLYLYNNQLSGSIPEEIGYLRSLTYLDLKENALNGSIPASLGNLNNLSRLYLYNNQLSGSIPEEIGYLSSLTNLYLGN

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEATALLKWKATFKNQNNSFLASWTTSSNACKDWYGVVC

ProfileScan: PS51450
IPR001611
96-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLENLDLSNNNISGTIPPEIGNL

FPrintScan: PR00019
97-110 LEURICHRPT,Leucine-rich repeat signature

LENLDLSNNNISGT

HMMPfam: PF12799
97-132 LRR_4,Leucine Rich repeats (2 copies)

LENLDLSNNNISGTIPPEIGNLTNLVYLDLNTNQIS

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNTNQISGTIPPQIGSL

ProfileScan: PS51450
IPR001611
168-190 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLGINFLSGSIPASLGNM

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLFLYENQLSGFIPEEIGYL

ProfileScan: PS51450
IPR001611
216-239 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKLSLDINFLSGSIPASLGNLN

HMMPfam: PF00560
IPR001611
240-260 LRR_1
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIG

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLYLYNNQLSGSIPEEIGYL

ProfileScan: PS51450
IPR001611
264-287 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLDLKENALNGSIPASLGNLN

HMMPfam: PF12799
264-300 LRR_4,Leucine Rich repeats (2 copies)

SLTYLDLKENALNGSIPASLGNLNNLSRLYLYNNQLS

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSRLYLYNNQLSGSIPEEIGYL

HMMPfam: PF13855
311-371 LRR_8,Leucine rich repeat

SSLTNLYLGNNSLIGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNL

ProfileScan: PS51450
IPR001611
312-333 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTNLYLGNNSLIGLIPASFGN

Gene3D: G3DSA:3.80.10.10
321-560 G3DSA:3.80.10.10

NSLIGLIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVD

superfamily: SSF52047
326-682 SSF52047,LRR

LIPASFGNMRNLQALFLNDNNLIGEIPSFVCNLTSLELLYMPRNNLKGKVPQCLGNISDLLVLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISSLQVFDMQNNKLSGTLPTNFSIGCSLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKLHGPIRSSGAEIMFPDLRIIDLSRNAFSQDLPTSLFEHLKGMRTVDKTMEEPSYEIYYDSVVVVTKGLELEIVRILSLYTVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQG

ProfileScan: PS51450
IPR001611
336-358 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQALFLNDNNLIGEIPSFVCNL

HMMPfam: PF13855
387-443 LRR_8,Leucine rich repeat

VLSMSSNSFSGELPSSISNLTSLKILDFGRNNLEGAIPQCFGNISSLQVFDMQNNKL

ProfileScan: PS51450
IPR001611
456-479 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLISLNLHGNELEDEIPWSLDNCK

HMMPfam: PF13855
456-515 LRR_8,Leucine rich repeat

SLISLNLHGNELEDEIPWSLDNCKKLQVLDLGDNQLNDTFPMWLGTLPELRVLRLTSNKL

ProfileScan: PS51450
IPR001611
480-503 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLGDNQLNDTFPMWLGTLP

ProfileScan: PS51450
IPR001611
530-552 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRIIDLSRNAFSQDLPTSLFEH

HMMPfam: PF00560
IPR001611
531-553 LRR_1
Leucine-rich repeat

LRIIDLSRNAFSQDLPTSLFEHL

Gene3D: G3DSA:3.80.10.10
594-681 G3DSA:3.80.10.10

TVIDLSSNKFEGHIPSVLGDLIAIRVLNVSHNALQGYIPSSLGSLSILESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQGCIPQ

HMMPfam: PF00560
IPR001611
617-638 LRR_1
Leucine-rich repeat

IRVLNVSHNALQGYIPSSLGSL

FPrintScan: PR00019
638-651 LEURICHRPT,Leucine-rich repeat signature

LSILESLDLSFNQL

ProfileScan: PS51450
IPR001611
640-663 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ILESLDLSFNQLSGEIPQQLASLT

HMMPfam: PF12799
641-676 LRR_4,Leucine Rich repeats (2 copies)

LESLDLSFNQLSGEIPQQLASLTFLEFLNLSHNYLQ

ProfileScan: PS51450
IPR001611
664-686 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLEFLNLSHNYLQGCIPQGPQFR


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox