PRGDB00049671 (Hcr2-2A)

From PRG Wiki
Jump to: navigation, search
Hcr2-2A
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3894388 (AF053996)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum pimpinellifolium

Comment?

Lycopersicon pimpinellifolium Hcr2-2A (Hcr2-2A) gene, complete cds.

DNA Sequence

ATGATGATGGTTTCCAGTAAAATATTCTCTTCACTTCAGTTTATCGCTCTTTTAAATCTCTTTACAGTTACTTTTGCTTCGAGTGAGGAAGCAACTGCCCTCTTGAAATGGATAGCAACTTTCAAGAACCAGGATGATTCCTTATTGGCTTCATGGACGCAAAGTTCTAATGCATGCAGGGACTGGTATGGAGTTATATGCTTTAATGGTAGGGTAAAAACGTTGAATATTACAAATTGCGGTGTCATTGGTACACTCTATGCTTTTCCGTTTTCATCTCTCCCTTTTCTTGAGAATCTTAATCTTAGCAACAACAATATCTCTGGCACCATTCCACCTGAGATTGGTAATCTCACTAATCTTGTCTATCTTGACTTGAACAACAATCAGATTTCAGGAACAATCCCACCACAAACCGGTTCACTATCAAAGCTTCAGATCCTCCGTATATTTGGCAACCATTTAAAGGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACCGATCTATCTTTGAGTACTAACTTTCTTAACGGTTCTATTCCTGCTTCGTTGGGGAAGTTAAACAACTTGTCTTTTTTGTCTCTTTATGATAATCAACTTTCTGGCTCTATTCCTGACGAAATAGATTACCTAACGTCTCTTACCGATTTGTATTTGAATAATAACTTTCTTAACGGTTCTATTCCTGCTTCACTGTGGAATTTGAAGAACTTGTCTTTTTTGTCTCTTCGTGAAAATCAACTTTCGGGCTATATTCCTCAAGAAATAGGCTACCTAAGGTCTCTCACTTATCTTCGTCTGAATAATAACTTTCTTAATGGTTCAATTCCTCGTGAAATAGGCTACCTAAGGTCTCTTACTAACCTTCATCTAAATAATAACTTTCTTAATGGTTCAATTCCTCCTGAAATAGGTAACCTAAGGTCTCTTAGTATCATAGATTTGAGTATTAACTCTCTTAAGGGTTCTATTCCTGCTTCATTGGGGAATTTGAGAAATGTGCAAAGTATGTTTCTTGATGAAAACAATCTCACTGAGGAAATTCCTTTATCTGTGTGCAATTTGACATCACTCAAAATTTTGTACTTGCGGAGAAACAACTTGAAGGGAAAAGTTCCGCAATGTTTGGGTAATATCAGTGGCCTCCAGGTTTTGACGATGTCACCTAATAACCTTAGTGGAGAGATCCCTTCATCTATTTCCAATTTAAGATCACTACAAATACTGGATTTGGGAAGAAATAGTCTGGAGGGAGCAATACCACAATGTTTTGGCAATATTAATACCCTTCAGGTTTTTGATGTGCAGAACAACAAACTTTCCGGGACTCTTTCAACAAATTTTAGCATTGGAAGTTCACTTATAAGTCTCAATTTGCATGGCAATGAACTAGAGGGGGAAATCCCTCGATCTTTGGCCAATTGCAAAAAGTTGCAAGTTCTTGATCTAGGAAATAATCATCTCAATGACACATTTCCCATGTGGTTGGGAACTTTGCTAGAGCTAAGAGTTTTAAGATTGACGTCGAATAAACTCCATGGACCCATAAGATCTTCAGGGGCTGAAATCATGTTTCCTGCTCTTCGAACCATAGATCTCTCTAACAATGCCTTCTCGAAAGACTTACCAACGAGTTTGTTTCAACACTTAAAAGGCATGAGGGCAATTGATAAAACAATGAAGGTACCAAGTTATGAAGGATATGGAGACTACCAAGACTCGATAGTTGTTGTATCAAAGGGATTGAAGCTTGAAGTTGTGAGAATTTTGTCTTTGTACACAGTTATCGATCTCTCAAACAACAAATTTGAAGGACATATTCCTAGTGTTCTAGGAGATTTCATTGCTCTTCGGGTGTTGAATATGTCTCACAATGGATTGAAAGGTCAAATACCACCATCGCTTGGAAGTTTATCTGTAGTGGAATCATTAGACCTTTCGTTTAACCAGCTTTCAGGAGAAATACCACAACAACTTGCTTCTCTTACGTCTCTTGGATTCTTAAATCTCTCCCACAATTATCTCCAAGGATGCATCCCTCAAGGGCCTCAATTTCGTACCTTTGAGAACAATTCATATGAAGGTAATGATGGATTACGTGGATACCCAGTTTCAAAAGGTTGTGGCAATGATCCTGTGCCAGAGACAAACTATACAGTATCTGCGCTAGACGATCAAGAAAGCAATTCAGAATTTCTCAATGATTTTTGGAAAGCTGCTCTGATGGGCTATGGAAGTGGACTATGTATTGGATTATCCATAATGTATTTCATGATCTCAACTAGAAATCCGAAATGGCTTGCAAGAATCATTGATGAAATGGAACACAAAATTAACATGCGAAGGATAAAGAAGCAGCAAGGTCAAAGGAATCACAGAAGAAGAAATAATCACTTCTAG


Protein sequences

Name Description Sequence
Hcr2-2A Hcr2-2A [Lycopersicon pimpinellifolium].

MMMVSSKIFSSLQFIALLNLFTVTFASSEEATALLKWIATFKNQDDSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGKLNNLSFLSLYDNQLSGSIPDEIDYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSLTYLRLNNNFLNGSIPREIGYLRSLTNLHLNNNFLNGSIPPEIGNLRSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLHGPIRSSGAEIMFPALRTIDLSNNAFSKDLPTSLFQHLKGMRAIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSYEGNDGLRGYPVSKGCGNDPVPETNYTVSALDDQESNSEFLNDFWKAALMGYGSGLCIGLSIMYFMISTRNPKWLARIIDEMEHKINMRRIKKQQGQRNHRRRNNHF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-680 PTHR24420:SF474,SUBFAMILY NOT NAMED

MMMVSSKIFSSLQFIALLNLFTVTFASSEEATALLKWIATFKNQDDSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGKLNNLSFLSLYDNQLSGSIPDEIDYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSLTYLRLNNNFLNGSIPREIGYLRSLTNLHLNNNFLNGSIPPEIGNLRSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLHGPIRSSGAEIMFPALRTIDLSNNAFSKDLPTSLFQHLKGMRAIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQG

HMMPanther: PTHR24420
1-680 PTHR24420,FAMILY NOT NAMED

MMMVSSKIFSSLQFIALLNLFTVTFASSEEATALLKWIATFKNQDDSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGKLNNLSFLSLYDNQLSGSIPDEIDYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSLTYLRLNNNFLNGSIPREIGYLRSLTNLHLNNNFLNGSIPPEIGNLRSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLHGPIRSSGAEIMFPALRTIDLSNNAFSKDLPTSLFQHLKGMRAIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQG

superfamily: SSF52058
24-301 SSF52058,LRR

TFASSEEATALLKWIATFKNQDDSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGKLNNLSFLSLYDNQLSGSIPDEIDYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSLTYLRLNNNFLNGSIPREIGYLRSLTNLHLNNNFLNG

HMMPfam: PF08263
IPR013210
28-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SEEATALLKWIATFKNQDDSLLASWTQSSNACRDWYGVIC

Gene3D: G3DSA:3.80.10.10
72-182 G3DSA:3.80.10.10

VKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGS

ProfileScan: PS51450
IPR001611
96-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLENLNLSNNNISGTIPPEIGNL

HMMPfam: PF12799
97-132 LRR_4,Leucine Rich repeats (2 copies)

LENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQIS

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNNNQISGTIPPQTGSL

ProfileScan: PS51450
IPR001611
144-166 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQILRIFGNHLKGSIPEEIGYL

ProfileScan: PS51450
IPR001611
168-191 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDLSLSTNFLNGSIPASLGKLN

Gene3D: G3DSA:3.80.10.10
183-385 G3DSA:3.80.10.10

IPASLGKLNNLSFLSLYDNQLSGSIPDEIDYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLRENQLSGYIPQEIGYLRSLTYLRLNNNFLNGSIPREIGYLRSLTNLHLNNNFLNGSIPPEIGNLRSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGL

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLSLYDNQLSGSIPDEIDYL

HMMPfam: PF00560
IPR001611
216-238 LRR_1
Leucine-rich repeat

SLTDLYLNNNFLNGSIPASLWNL

ProfileScan: PS51450
IPR001611
216-239 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDLYLNNNFLNGSIPASLWNLK

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLSLRENQLSGYIPQEIGYL

ProfileScan: PS51450
IPR001611
264-286 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTYLRLNNNFLNGSIPREIGYL

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTNLHLNNNFLNGSIPPEIGNL

superfamily: SSF52047
302-696 SSF52047,LRR

SIPPEIGNLRSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLHGPIRSSGAEIMFPALRTIDLSNNAFSKDLPTSLFQHLKGMRAIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSY

ProfileScan: PS51450
IPR001611
312-335 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSIIDLSINSLKGSIPASLGNLR

ProfileScan: PS51450
IPR001611
336-357 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NVQSMFLDENNLTEEIPLSVCN

HMMPfam: PF13855
359-419 LRR_8,Leucine rich repeat

TSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSL

ProfileScan: PS51450
IPR001611
360-382 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILYLRRNNLKGKVPQCLGNI

ProfileScan: PS51450
IPR001611
384-406 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQVLTMSPNNLSGEIPSSISNL

Gene3D: G3DSA:3.80.10.10
386-559 G3DSA:3.80.10.10

QVLTMSPNNLSGEIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLHGPIRSSGAEIMFPALRTIDLSNNAFSKDLPTSLFQHLKGMRAI

HMMPfam: PF12799
456-493 LRR_4,Leucine Rich repeats (2 copies)

SLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLND

ProfileScan: PS51450
IPR001611
456-479 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLISLNLHGNELEGEIPRSLANCK

ProfileScan: PS51450
IPR001611
480-501 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLGNNHLNDTFPMWLGT

ProfileScan: PS51450
IPR001611
530-552 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALRTIDLSNNAFSKDLPTSLFQH

HMMPfam: PF00560
IPR001611
531-553 LRR_1
Leucine-rich repeat

LRTIDLSNNAFSKDLPTSLFQHL

Gene3D: G3DSA:3.80.10.10
597-706 G3DSA:3.80.10.10

TVIDLSNNKFEGHIPSVLGDFIALRVLNMSHNGLKGQIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSYEGNDGLRGYP

ProfileScan: PS51450
IPR001611
619-641 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALRVLNMSHNGLKGQIPPSLGSL

HMMPfam: PF00560
IPR001611
620-641 LRR_1
Leucine-rich repeat

LRVLNMSHNGLKGQIPPSLGSL

ProfileScan: PS51450
IPR001611
643-666 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VVESLDLSFNQLSGEIPQQLASLT

HMMPfam: PF12799
645-679 LRR_4,Leucine Rich repeats (2 copies)

ESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQ

ProfileScan: PS51450
IPR001611
667-689 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLGFLNLSHNYLQGCIPQGPQFR


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox