PRGDB00049673 (Hcr2-0A)

From PRG Wiki
Jump to: navigation, search
Hcr2-0A
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 3894384 (AF053994)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicum

Comment?

Lycopersicon esculentum Hcr2-0A (Hcr2-0A) gene, complete cds.

DNA Sequence

ATGATGATGGTTTCCAGTAAAATCTTCTCTTTACTTCAGTTTTTCGCTCTTTTAAATCTCTTTACAGTTACTTTTGCTTCGACTGAGGAAGCAACTGCCCTCTTGAAATGGAAAGCAACTTTCAAGAACCAGGATAATTCCTTATTGGCTTCATGGACGCAAAGTTCTAATGCATGCAGGGACTGGTATGGAGTTATATGCTTTAATGGTAGGGTAAAAACGTTGAATATTACAAATTGCGGTGTCATTGGTACACTCTATGCTTTTCCGTTTTCATCTCTCCCTTTTCTTGAGAATCTTAATCTTAGCAACAACAATATCTCTGGCACCATTCCACCTGAGATTGGTAATCTCACTAATCTTGTCTATCTTGACTTGAACAACAATCAGATTTCAGGAACAATCCCACCACAAACCGGTTCACTATCAAAGCTTCAGATCCTCCGTATATTTGGCAACCATTTAAAGGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACCGATCTATCTTTGAGTACTAACTTTCTTAACGGTTCTATTCCTGCTTCGTTGGGGAATTTAAACAACTTGTCTTTTTTGTCTCTTTATGATAATCAACTTTCTGGCTCTATTCCTGAAGAAATAGGTTACCTAAGGTCTCTTACCGATCTATATTTGAGTACTAACTTTCTTAACGGTTCTATTCCTGCTTCATTGGGGAATTTAAACAACTTGTCTTTTTTGTCTCTTTATGATAATAAACTTTCTGGCTCTATTCCTGACGAAATAGGTTACCTAACTTCTCTTACCGATTTATATTTGAATAATAACTTTCTAAACGGTTCTATTCCTGCTTCACTGTGGAATTTGAAGAACTTGTCTTTTTTGTCTCTTAGTGAAAATCAACTTTCGGGCTCTATTCCTCAAGAAATAGGCTACCTAAGGTCTCTTACTAACCTTCATCTAAATAATAACTTTCTTAATGGTTCAATTCCTCCTGAAATAGGTAACCTATGGTCTCTTAGTATCATAGATTTGAGTATTAACTCCCTTAAGGGTTCTATTCCTGCTTCATTGGGGAATTTGAGAAATGTGCAAAGTATGTTTCTTGATGAAAACAATCTCACCGAGGAAATTCCTTTATCTGTGTGCAATTTGACATCACTCAAAATTTTGTACTTGCGGAGAAACAACTTGAAGGGAAAAGTTCCGCAATGTTTGGGTAATATCAGTGGCCTCCAGGTTTTGACGATGTCACGTAATAACCTTAGTGGAGTGATCCCTTCATCTATTTCCAATTTAAGATCACTACAAATACTGGATTTGGGAAGAAATAGTCTGGAGGGAGCAATACCACAATGTTTTGGCAATATTAATACCCTTCAGGTTTTTGATGTGCAGAACAACAAACTTTCTGGGACTCTTTCAACAAATTTTAGCATTGGAAGTTCACTTATAAGTCTGAATTTGCATGGCAATGAACTAGAGGGGGAAATCCCTCGATCTTTGGCCAATTGCAAAAAGTTGCAAGTTCTTGATCTAGGAAATAATCATCTCAATGACACATTCCCCATGTGGTTGGGAACTTTGCTAGAGTTGAGAGTTTTAAGATTGACGTCGAATAAACTCTATGGACCCATAAGATCTTCAGGGGCTGAAATCATGTTTCCTGATCTTCGAACCATAGATCTCTCTAACAATGCCTTCTCGAAAGACTTACCAACGAGTTTGTTTCAACACTTAGAAGGCATGAGGACAATTGATAAAACAATGAAGGTACCAAGTTATGAAGGATATGGAGACTACCAAGACTCGATAGTTGTTGTATCAAAGGGATTGAAGCTTGAAGTTGTGAGAATTTTGTCTTTGTACACAGTTATCGATCTTTCAAACAACAAATTTGAAGGACATATTCCTAGTGTTCTAGGAGATCTCATTGCTCTTCGGGTGTTGAATATGTCTCACAATGGATTGAAAGGTCATATACCACCATCGCTTGGAAGTTTATCTGTAGTGGAATCATTAGACCTTTCGTTTAACCAGCTTTCAGGAGAAATACCACAACAACTTGCTTCTCTTACGTCTCTTGGATTCTTAAATCTCTCCCACAATTATCTCCAAGGATGCATCCCTCAAGGGCCTCAATTTCGTACCTTTGAGAACAATTCATATGAAGGTAATGATGGATTACGTGGATATCCAGTTTCAAAAGGTTGTGGCAATGATCCTGTGCCAGATACAAACTATACAGTATCTGCTCTAGACGATCAAGAAAGCAATTCAGAATTTCTCAATGATTTTTGGAAAGCTGCTCTGATGGGCTATGGCAGTGGACTATGTATTGGATTATCCATAATGTATTTCATGATCTCAACTGGAAATCCGATATGGCTTGCAAGAATCATTGATGAAATGGAACACCAAATTAACACGCGAAGGAGAAAGAAGCAGCAAGGTCAAAGGAATCACAGAAGAAGAAATAATCATTTCTAG


Protein sequences

Name Description Sequence
Hcr2-0A Hcr2-0A [Lycopersicon esculentum].

MMMVSSKIFSLLQFFALLNLFTVTFASTEEATALLKWKATFKNQDNSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGNLNNLSFLSLYDNQLSGSIPEEIGYLRSLTDLYLSTNFLNGSIPASLGNLNNLSFLSLYDNKLSGSIPDEIGYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLSENQLSGSIPQEIGYLRSLTNLHLNNNFLNGSIPPEIGNLWSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLYGPIRSSGAEIMFPDLRTIDLSNNAFSKDLPTSLFQHLEGMRTIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDLIALRVLNMSHNGLKGHIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSYEGNDGLRGYPVSKGCGNDPVPDTNYTVSALDDQESNSEFLNDFWKAALMGYGSGLCIGLSIMYFMISTGNPIWLARIIDEMEHQINTRRRKKQQGQRNHRRRNNHF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-726 PTHR24420,FAMILY NOT NAMED

MMMVSSKIFSLLQFFALLNLFTVTFASTEEATALLKWKATFKNQDNSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGNLNNLSFLSLYDNQLSGSIPEEIGYLRSLTDLYLSTNFLNGSIPASLGNLNNLSFLSLYDNKLSGSIPDEIGYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLSENQLSGSIPQEIGYLRSLTNLHLNNNFLNGSIPPEIGNLWSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLYGPIRSSGAEIMFPDLRTIDLSNNAFSKDLPTSLFQHLEGMRTIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDLIALRVLNMSHNGLKGHIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSYEGNDGL

HMMPanther: PTHR24420:SF472
1-726 PTHR24420:SF472,SUBFAMILY NOT NAMED

MMMVSSKIFSLLQFFALLNLFTVTFASTEEATALLKWKATFKNQDNSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGNLNNLSFLSLYDNQLSGSIPEEIGYLRSLTDLYLSTNFLNGSIPASLGNLNNLSFLSLYDNKLSGSIPDEIGYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLSENQLSGSIPQEIGYLRSLTNLHLNNNFLNGSIPPEIGNLWSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLYGPIRSSGAEIMFPDLRTIDLSNNAFSKDLPTSLFQHLEGMRTIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDLIALRVLNMSHNGLKGHIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSYEGNDGL

superfamily: SSF52058
24-321 SSF52058,LRR

TFASTEEATALLKWKATFKNQDNSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGNLNNLSFLSLYDNQLSGSIPEEIGYLRSLTDLYLSTNFLNGSIPASLGNLNNLSFLSLYDNKLSGSIPDEIGYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLSENQLSGSIPQEIGYLRSLTNLHLNNN

Gene3D: G3DSA:3.80.10.10
29-216 G3DSA:3.80.10.10

EEATALLKWKATFKNQDNSLLASWTQSSNACRDWYGVICFNGRVKTLNITNCGVIGTLYAFPFSSLPFLENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQISGTIPPQTGSLSKLQILRIFGNHLKGSIPEEIGYLRSLTDLSLSTNFLNGSIPASLGNLNNLSFLSLYDNQLSGSIPEEIGYLRS

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

EEATALLKWKATFKNQDNSLLASWTQSSNACRDWYGVIC

ProfileScan: PS51450
IPR001611
96-118 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLENLNLSNNNISGTIPPEIGNL

HMMPfam: PF12799
97-132 LRR_4,Leucine Rich repeats (2 copies)

LENLNLSNNNISGTIPPEIGNLTNLVYLDLNNNQIS

ProfileScan: PS51450
IPR001611
120-142 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVYLDLNNNQISGTIPPQTGSL

ProfileScan: PS51450
IPR001611
144-166 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQILRIFGNHLKGSIPEEIGYL

ProfileScan: PS51450
IPR001611
168-191 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDLSLSTNFLNGSIPASLGNLN

ProfileScan: PS51450
IPR001611
192-214 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLSLYDNQLSGSIPEEIGYL

ProfileScan: PS51450
IPR001611
216-239 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDLYLSTNFLNGSIPASLGNLN

Gene3D: G3DSA:3.80.10.10
217-411 G3DSA:3.80.10.10

LTDLYLSTNFLNGSIPASLGNLNNLSFLSLYDNKLSGSIPDEIGYLTSLTDLYLNNNFLNGSIPASLWNLKNLSFLSLSENQLSGSIPQEIGYLRSLTNLHLNNNFLNGSIPPEIGNLWSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQV

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLSLYDNKLSGSIPDEIGYL

HMMPfam: PF00560
IPR001611
264-286 LRR_1
Leucine-rich repeat

SLTDLYLNNNFLNGSIPASLWNL

ProfileScan: PS51450
IPR001611
264-287 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDLYLNNNFLNGSIPASLWNLK

ProfileScan: PS51450
IPR001611
288-310 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLSFLSLSENQLSGSIPQEIGYL

ProfileScan: PS51450
IPR001611
312-334 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTNLHLNNNFLNGSIPPEIGNL

superfamily: SSF52047
326-720 SSF52047,LRR

SIPPEIGNLWSLSIIDLSINSLKGSIPASLGNLRNVQSMFLDENNLTEEIPLSVCNLTSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLYGPIRSSGAEIMFPDLRTIDLSNNAFSKDLPTSLFQHLEGMRTIDKTMKVPSYEGYGDYQDSIVVVSKGLKLEVVRILSLYTVIDLSNNKFEGHIPSVLGDLIALRVLNMSHNGLKGHIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSY

ProfileScan: PS51450
IPR001611
336-359 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSIIDLSINSLKGSIPASLGNLR

ProfileScan: PS51450
IPR001611
360-381 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NVQSMFLDENNLTEEIPLSVCN

HMMPfam: PF13855
383-443 LRR_8,Leucine rich repeat

TSLKILYLRRNNLKGKVPQCLGNISGLQVLTMSRNNLSGVIPSSISNLRSLQILDLGRNSL

ProfileScan: PS51450
IPR001611
384-406 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILYLRRNNLKGKVPQCLGNI

ProfileScan: PS51450
IPR001611
408-429 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLQVLTMSRNNLSGVIPSSISN

Gene3D: G3DSA:3.80.10.10
412-584 G3DSA:3.80.10.10

LTMSRNNLSGVIPSSISNLRSLQILDLGRNSLEGAIPQCFGNINTLQVFDVQNNKLSGTLSTNFSIGSSLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLNDTFPMWLGTLLELRVLRLTSNKLYGPIRSSGAEIMFPDLRTIDLSNNAFSKDLPTSLFQHLEGMRTID

HMMPfam: PF12799
480-517 LRR_4,Leucine Rich repeats (2 copies)

SLISLNLHGNELEGEIPRSLANCKKLQVLDLGNNHLND

ProfileScan: PS51450
IPR001611
480-503 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLISLNLHGNELEGEIPRSLANCK

ProfileScan: PS51450
IPR001611
504-525 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQVLDLGNNHLNDTFPMWLGT

ProfileScan: PS51450
IPR001611
554-576 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DLRTIDLSNNAFSKDLPTSLFQH

HMMPfam: PF00560
IPR001611
555-577 LRR_1
Leucine-rich repeat

LRTIDLSNNAFSKDLPTSLFQHL

Gene3D: G3DSA:3.80.10.10
621-730 G3DSA:3.80.10.10

TVIDLSNNKFEGHIPSVLGDLIALRVLNMSHNGLKGHIPPSLGSLSVVESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQGCIPQGPQFRTFENNSYEGNDGLRGYP

ProfileScan: PS51450
IPR001611
643-665 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALRVLNMSHNGLKGHIPPSLGSL

HMMPfam: PF00560
IPR001611
644-665 LRR_1
Leucine-rich repeat

LRVLNMSHNGLKGHIPPSLGSL

ProfileScan: PS51450
IPR001611
667-690 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VVESLDLSFNQLSGEIPQQLASLT

HMMPfam: PF12799
669-703 LRR_4,Leucine Rich repeats (2 copies)

ESLDLSFNQLSGEIPQQLASLTSLGFLNLSHNYLQ

ProfileScan: PS51450
IPR001611
691-713 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLGFLNLSHNYLQGCIPQGPQFR


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox