PRGDB00049675 (St121)

From PRG Wiki
Jump to: navigation, search
St121
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 1708711 (U60070)
Gene Class N
Domain Type NBS
Gene Species Solanum tuberosum

Comment?

Solanum tuberosum disease resistance homolog (St121) gene, partial cds.

DNA Sequence

CTTCGAAAAGTGTTTACAACGATGAGAAGGTAAAAAACCATTTTGGTTTGAAAGCTTGGATCTGTGTGTCTGAACCGTATGATATTCTCAGAATAACAAAGGAGTTACTTCAAGAAATTGGTTTAACGGTTGACAACAATCTGAATCAACTGCAAGTCAAATTGAAGGAGAGCTTAAAGGGAAAAAAGTTTCTTATTGTCCTAGATGATGTGTGGAATGACGACTATAAAGAGTGGGATGACTTGAGAAATCTTTTTGTACAAGGAGATGTAGGAAGTAAGATCATTGTGACGACACGTAAGGAGAGTGTTGCCTTGATGATGGGTAGTGGGGCAATCAATGTGGGAACTCTGTCTAGTGAAGTCTCTTGGGCTCTATTCAAACGGCATTCATTTGAAAATAGGGATCCTGAGGAATATTCAGAATTTCAAGAGGTTGGAAAACAAATTGCATACAATC


Protein sequences

Name Description Sequence
121.pep 121.pep.

SKSVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEIGLTVDNNLNQLQVKLKESLKGKKFLIVLDDVWNDDYKEWDDLRNLFVQGDVGSKIIVTTRKESVALMMGSGAINVGTLSSEVSWALFKRHSFENRDPEEYSEFQEVGKQIAYN


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
2-150 NB-ARC,NBS
NB-ARC

KSVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEIGLTVDNNLNQLQVKLKESLKGKKFLIVLDDVWNDDYKEWDDLRNLFVQGDVGSKIIVTTRKESVALMMGSGAINVGTLSSEVSWALFKRHSFENRDPEEYSEFQEVGKQIA

superfamily: SSF52540
2-147 SSF52540

KSVYNDEKVKNHFGLKAWICVSEPYDILRITKELLQEIGLTVDNNLNQLQVKLKESLKGKKFLIVLDDVWNDDYKEWDDLRNLFVQGDVGSKIIVTTRKESVALMMGSGAINVGTLSSEVSWALFKRHSFENRDPEEYSEFQEVGK


List of References

D Leister, A Ballvora, F Salamini, C Gebhardt
A PCR-based approach for isolating pathogen resistance genes from potato with potential for wide application in plants.
Nat. Genet.: 1996, 14(4);421-9
PubMed:8944022 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox