PRGDB00049678 (receptor kinase-like protein)

From PRG Wiki
Jump to: navigation, search
receptor kinase-like protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2586086 (U72724)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa receptor kinase-like protein gene, family member E, complete cds.

DNA Sequence

ATGATATCACTCCCATTACTGCTCTTCGTCCTCTTCTTCTCTGCGCTGCTGCTCTTCCCTTCGAGCAGTGACGACGACGGTGGTGGTGATGCTGCCGGCGACGAACTCGCGCTGCTCTCTTTCAAGTCATCCCTGCTATACCAGGGGGGCCAGTCGCTGGCATCTTGGAACACGTCCGGCCATGGCCAGCACTGCACATGGGTGGGTGTCGTGTGCGGCCGCCGGCACCCACACAGGGTGGTGAAGCTGCGGCTGCGCTCCTCCAACCTGGCCGGGATCATCTCGCCGTCGCTGGGCAACCTATCCTTCCTCAGGACGCTGCAACTCAGCGACAACCACCTGTCCGGCAAGATACCCCAGGAGCTCAGCCGTCTCAGCAGGCTCCAGCAACTGGTACTGAATTTCAACAGCCTATCGGGTGAGATTCCAGCTGCTTTGGGCAATCTAACCAGTCTCTCGGTTCTTGAGCTGACTAACAATACACTGTCCGGAGCAATCCCTTCATCTCTGGGCAAACTCACAGGTCTCACTGATCTTGCACTGGCTGAAAATACGCTGTCTGGTTCCATCCCATCATCTTTCGGCCAATTGCGCAGATTATCTTTCCTTAGCTTAGCCTTTAACAATTTAAGTGGAGCGATCCCAGATCCTATTTGGAACATCTCCTCTCTCACCATATTCGAAGTCATATCCAACAAGCTAAGTGGTACACTGCCTACAAATGCATTCAGTAATCTTCCTAGTCTGCAGGAGGTATACATGTATTACAACCAGTTTCATGGTCGTATCCCGGCATCGATAGGTAATGCTTCCAACATCTCAATATTTACCATTGGTTTAAACTCTTTTAGCGGTGTTGTTCCACCGGAGATTGGAAGGATGAGAAATCTTCAGAGACTAGAGCTTCCAGAAACTCTTTCGGAAGCTGAAGAAACAAATGATTGGAAATTCATGACGGCATTGACAAATTGCTCCAATCTTCAAGAAGTGGAACTGGGAGGTTGTAAATTTGGTGGAGTCCTCCCTGATTCTGTTTCCAATCTTTCCTCTTCGCTTGTATCTCTCTCCATTAGAGATAACAAAATTTCAGGGAGCTTACCTAGAGATATCGGTAATCTCGTTAATTTACAATATCTTTCTCTCGCTAACAACTCCTTGACAGGATCCCTTCCCTCTTCCTTCAGCAAGCTTAAAAATTTACGTCGTCTCACTGTAGATAACAACAAGTTAATTGGTTCTCTCCCATTGACCATCGGTAATCTTACACAACTAACTAATATGGAGGTCCAATTTAATGCCTTCGGTGGTACAATACCAAGCACACTTGGAAACCTGACCAAGCTGTTTCAAATAAATCTTGGCCACAATAACTTTATAGGGCAAATTCCCATTGAAATATTTAGCATTCCCGCACTCTCTGAAATTTTGGATGTGTCCCATAATAACTTGGAGGGATCAATACCAAAAGAAATAGGGAAACTTAAAAATATTGTCGAATTCCATGCTGATTCGAACAAATTATCGGGTGAGAACCCTAGCACCATTGGTGAATGCCAACTTCTGCAGCATCTTTTCCTGCAAAACAATTTCTTAAATGGTAGCATCCCAATAGCTCTGACTCAGTTGAAAGGTCTGGACACACTTGATCTCTCAGGTAACAATTTGTCAGGTCAGATACCTATGTCCTTAGGGGACATGCCTCTTCTCCACTCGCTGAACCTTTCGTTCAACAGCTTCCACGGTGAAGTGCCAACCAATGGTGTTTTTGCAAATGCTTCTGAAATTTACATCCAAGGCAATGCCCATATTTGCGGTGGCATACCTGAACTACATCTTCCGACGTGTTCCTTAAAATCAAGAAAGAAAAAGAAACATCAAATTCTGCTGTTAGTGGTTGTTATCTGTCTCGTTTCGACACTTGCCGTCTTTTCGTTACTCTACATGCTTCTAACCTGTCATAAGAGAAGAAAGAAAGAAGTCCCTGCAACGACATCCATGCAAGGCCACCCAATGATCACTTACAAGCAGCTGGTAAAAGCAACGGATGGTTTTTCGTCCAGCCATTTGTTGGGTTCTGGATCTTTTGGCTCTGTTTACAAAGGAGAATTTGATAGTCAAGATGGTGAAATCACAAGTCTTGTTGCCGTGAGGGTACTAAAGCTGGAAACTCCAAAGGCACTCAAGAGTTTCACGGCCGAATGCGAAACACTGCGAAATACTCGACACCGGAATCTTGTCAAGATAGTTACGATTTGCTCGAGCATCGATAACAGAGGGAATGATTTCAAAGCAATTGTGTATGACTTCATGCCCAATGGCAGTCTGGAAGATTGGCTACACCCTGAAACAAATGATCAAGCAGAGCAAAGGCACTTGACTCTGCATCAGAGAGTGTCACGCCGGAATTTCTATCCAAAATTCCAAACGCTTACATGTGTGTGA


Protein sequences

Name Description Sequence
receptor kinase-like protein receptor kinase-like protein [Oryza sativa].

MISLPLLLFVLFFSALLLFPSSSDDDGGGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLSEAEETNDWKFMTALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICGGIPELHLPTCSLKSRKKKKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVRVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVSRRNFYPKFQTLTCV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-799 PTHR24420,FAMILY NOT NAMED

MISLPLLLFVLFFSALLLFPSSSDDDGGGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLSEAEETNDWKFMTALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICGGIPELHLPTCSLKSRKKKKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVRVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVS

HMMPanther: PTHR24420:SF474
1-799 PTHR24420:SF474,SUBFAMILY NOT NAMED

MISLPLLLFVLFFSALLLFPSSSDDDGGGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQRLELPETLSEAEETNDWKFMTALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICGGIPELHLPTCSLKSRKKKKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVRVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVS

superfamily: SSF52058
28-302 SSF52058,LRR

GGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQRLEL

HMMPfam: PF08263
IPR013210
32-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

AGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVC

Gene3D: G3DSA:3.80.10.10
34-302 G3DSA:3.80.10.10

DELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRHPHRVVKLRLRSSNLAGIISPSLGNLSFLRTLQLSDNHLSGKIPQELSRLSRLQQLVLNFNSLSGEIPAALGNLTSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNLSGAIPDPIWNISSLTIFEVISNKLSGTLPTNAFSNLPSLQEVYMYYNQFHGRIPASIGNASNISIFTIGLNSFSGVVPPEIGRMRNLQRLEL

HMMPfam: PF13516
101-123 LRR_6,Leucine Rich repeat

LSFLRTLQLSDNHLSGKIPQELS

HMMPfam: PF13855
150-210 LRR_8,Leucine rich repeat

TSLSVLELTNNTLSGAIPSSLGKLTGLTDLALAENTLSGSIPSSFGQLRRLSFLSLAFNNL

Gene3D: G3DSA:3.80.10.10
320-604 G3DSA:3.80.10.10

ALTNCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHIC

superfamily: SSF52058
323-605 SSF52058,LRR

NCSNLQEVELGGCKFGGVLPDSVSNLSSSLVSLSIRDNKISGSLPRDIGNLVNLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKLIGSLPLTIGNLTQLTNMEVQFNAFGGTIPSTLGNLTKLFQINLGHNNFIGQIPIEIFSIPALSEILDVSHNNLEGSIPKEIGKLKNIVEFHADSNKLSGENPSTIGECQLLQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNSFHGEVPTNGVFANASEIYIQGNAHICG

HMMPfam: PF12799
375-410 LRR_4,Leucine Rich repeats (2 copies)

NLQYLSLANNSLTGSLPSSFSKLKNLRRLTVDNNKL

HMMPfam: PF00560
IPR001611
474-494 LRR_1
Leucine-rich repeat

EILDVSHNNLEGSIPKEIGKL

HMMPfam: PF13855
521-578 LRR_8,Leucine rich repeat

LQHLFLQNNFLNGSIPIALTQLKGLDTLDLSGNNLSGQIPMSLGDMPLLHSLNLSFNS

Gene3D: G3DSA:2.60.120.200
IPR013320
612-689 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

LPTCSLKSRKKKKHQILLLVVVICLVSTLAVFSLLYMLLTCHKRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHL

superfamily: SSF56112
IPR011009
654-780 Kinase_like
Protein kinase-like domain

KRRKKEVPATTSMQGHPMITYKQLVKATDGFSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVRVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLH

ProfileScan: PS50011
IPR000719
684-813 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSSHLLGSGSFGSVYKGEFDSQDGEITSLVAVRVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLTLHQRVSRRNFYPKFQTLTCV

HMMPfam: PF07714
IPR001245
687-793 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SHLLGSGSFGSVYKGEFDSQDGEITSLVAVRVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPETNDQAEQRHLT

Gene3D: G3DSA:3.30.200.20
690-782 G3DSA:3.30.200.20

LGSGSFGSVYKGEFDSQDGEITSLVAVRVLKLETPKALKSFTAECETLRNTRHRNLVKIVTICSSIDNRGNDFKAIVYDFMPNGSLEDWLHPE

PatternScan: PS00107
IPR017441
690-720 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGSGSFGSVYKGEFDSQDGEITSLVAVRVLK


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox