PRGDB00049679 (gag/pol)

From PRG Wiki
Jump to: navigation, search
gag/pol
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2586078 (U72726)
Gene Class Unknown
Domain Type
Gene Species Oryza longistaminata

Comment?

Oryza longistaminata receptor kinase-like protein, family member D, and retrofit (gag/pol) genes, complete cds.

DNA Sequence

ATGGCGTCGTCGTCGTCTTCCTCAGGCGCGGCAGCCGCCAATCTCCTCCAAGGCCACTCGGTTTCAGAGAAACTCGGGAAAGCCAACCATGCATTGTGGAAAGCGCAAGTTAGCGCTGCAGTGCGTGGAGCCCGATTGCTGGGCTACCTCAACGGCGATATCAAAGCTCCAGACGCCGAACTCTCGGTCACCATAGATGGGAAGACCACAACAAAGCCGAATCCGGCATTTGAAGATTGGGAGGCCAATGACCAGCTTGTTCTTGGCTATCTCCTGTCATCTCTTTCAAGGGATGTGCTGATCCAAGTCGCCACATGCAAGACGGCGGCTGAGGCATGGCGGAGCATTGAAGCACTCTACTCCACCGGCACTCGAGCAAGGGCGGTGAACACCAGACTCGCCCTCACCAACACGAAGAAAGGAACAATGAAGATCGCCGAGTATGTCGCCAAGATGCGAGCGCTTGGTGATGAGATGGCTGCCGGCGGTCATCCACTTGATGAAGAAGACCTTGTCCAGTACATCATCGCTGGGCTAAATGAAGACTTCAGCCCGATCGTCTCCAACCTCTGCAACAAGTCCGATCCCATCACGGTTGGGGAGCTGTATTCTCAGCTCGTCAACTTTGAAACCCTCCTTGATCTCTACCGCAGCACTGGTCAGGGAGGAGCTGCTTTTGTCGCTAATCGCGGCAGGGGCGGCGGCGGCGGCGGGCGCGGCAACAACAACAACTCCGGCGGCGGCGGCGGCAGAAGCGCGCCGGGTGGACGCGGCAGCGGCAGCCAGGGTCGCGGTGGCCGTGGACGCGGCACAGGAGGCCAAGACAGGCGCCCTACTTGCCAAGTTTGTTTCAAGCGTGGGCATACAGCAGCTGATTGTTGGTATCGCTTCGACGAGGACTACGTTGCAGATGAGAAGCTCGTTGCTGCTGCTACTAACTCGTATGGTATAGATACAAATTGGTATATTGATACAGGTGCTACAGATCACATTACCGGTGAACTAGAGAAGCTTACCACCAAGGAGAAATACAACGGCGGCGAGCAAATTCACACTGCTAGCGGAGCAGGTATGGATATTAGTCACATTGGTCATACTATTGTGCATACCCCTAGCCGTAATATTCATCTAAATAATGTCCTTTATGTTCCTCAAGCCAAGAAAAATCTTATATCTGCTAGTCAATTAGCCGCTGATAATTCTGCTTTTCTTGAACTTCACTCGAAATTCTTTTCTATAAAGGATCAGGTAACGAGGGACGTTCTGCTTGAAGGGAAATGTAGACACGGTCTCTACCCGATCCCCAAGTTCTTTGGTCGCTCAACCAACAAACAAGCCCTTGGTGCCGCCAAGTTATCCCTGTCTAGGTGGCATAGCCGTCTAGGACATCCGTCTCTTCCTATTGTTAAGCAAGTCATTAGCAGAAATAATCTCCCATGTTCAGTTGAGTCAGTCAATCAGTCTGTGTGTAATGCTTGCCAAGAAGCAAAGAGTCATCAGTTACCTTATATTAGATCTACTAGTGTGTCTCAATTTCCTCTTGAACTTGTTTTTTCTGATGTTTGGGGCCCTGCTCCAGAGTCTGTTGGGAGAAATAAATATTATGTGAGTTTCATTGATGATTTTAGTAAGTTTACTTGGATATACTTGCTGAAATACAAGTCTGAGGTTTTTGAGAAATTTAAAGAATTTCAGGCTTTAGTTGAACGAATGTTTGATAGAAAGATTATTGCCATGCAGACTGATTGGCGGGGGGGGAGATATCAGAAACTTAATTCCTTTTTTGCTCAAATAGGATTGATCATCATGTGTCATGTCCTCACACTCATCAGGCAGAATGGGTCAGCTGAGAGAAAACACCGGCATATCGTGGAAGTAGGCCTTTCTCTTTTATCTTATGCATCAATGCCTCTTAAGTTTTGGGATGAAGCCTTTGTTGCAGCCACTTATCTCATCAATCGTATACCTAGTAAAACCATCCAAAATTCTACACCCCTAGAGAAACTGTTTAACCAAAAACCTGACTACTCATCCTTGAGAGTGTTTGGTTGTGCATGTTGGCCTCATCTTCGCCCTTACAATACACACAAACTCCAGTTTCGCTCCAAACAGTGCGTGTTTTTGGGTTTTAGTACTCACCACAAAGGATTTAAGTGTCTTGATGTGTCATCAGGCCGTGTCTACATCTCAAGAGATGTTGTCTTTGATGAAAATGTTTTTCCCTTCTCTACACTCCACTCAAATGCAGGAGCCAGACTCAGGTCTGAAATTCTTTTGTTGCCGTCCCCCTTGACAAACTATAATACGGCTAGTGCAGGGGGAACACATGTAGTTGCACCAGTGGCTAATACTCCATTACCTAGTGATAATTTAATTTCTAATGCTGCTGATGTGACTTCTGGAGAAAATAGTGCAGCACATGAACAGGAAATGGAGAATGAGCAGGAAATAGAGAACGTCATGCATGGGAACGACGTGCATGGGGACGCGGCATCGGGACCTGTGCTGGATCAACCAACTGCTGACAGCAGCACTGCGCCGGACCAGGGAGCTGACACCAGTGACGCGGTCTCTGGCGCAGCTTCTGACGCGGGTGGAGACACTGCCACCCTGGGAGCTGGAGCAGCAAATAGCGCAGCAGCAGGTGGTGAAGAATCCCAGCCGGTGCAGCCTGATGTGACGGGTACAGTACTGGCTACAGTAGCCCCTGCATCGAGACCACACACTCGTCTGCGGAGTGGTATTCGAAAAGAGAAGGTATACACTGATGGCACCGTTAAATATGGTTGTTTTTCTTCTACTGGTGAACCACAAAATGATAAAGAGGCTTTAGGAGATAAAAACTGGAGAGATGCAATGGAAACTGAGTATAATGCTTTGATAAAAAATGACACATGGCACCTAGTTCCATATGAGAAAGGACAAAATATCATTGGGTGTAAATGGGTATATAAGATTAAAAGGAAGGCAGATGGGACACTTGATAGATACAAAGCTAGACTTGTAGCAAAGGGGTTTAAACAAAGATATGGTATCGATTATGAAGATACTTTTAGTCCTGTTGTTAAAGCTGCTACTATTAGAATTATTCTGTCCATTGCTGTCTCTAGAGGTTGGAGTCTTAGACAGTTAGATGTTCAGAATGCCTTTCTTCATGGATTCTTAGAAGAAGAAGTCTACATGCAACAACCTCCTGGGTTTGAGTCATCCTCTAAACCTGATTATGTATGTAAATTGGATAAGGCATTATATGGGCTGAAACAAGCACCAAGGGCGTGGTATTCCAGGCTGAGTAAGAAACTTGTTGAACTTGGTTTTGAAGCTTCAAAGGCTGATACCTCATTATTCTTTCTTAACAAAGGAGGGATACTTATGTTTGTTTTGGTATATGTTGATGATATAATTGTAGCTAGCTCTACAGAGAAGGCAACTACAGCACTTCTGAAGGATCTAAACAAGGAGTTCGCACTTAAGGATTTGGGAGACCTGCACTACTTCCTTGGAATTGAGGTAACTAAAGTTTCCAATGGCGTTATCTTGACTCAAGAGAAGTATGCAAATGATCTGCTAAAGAGAGTTAATATGTCAAATTGCAAGCCAGTTAGTACTCCTCTTTCTGTTAGTGAAAAATTAACTCTATATGAGGGATCACCCTTGGGTCCTAATGATGCAATACAATATAGAAGTATAGTTGGTGCTTTACAATACTTGACCTTGACAAGACCTGACATAGCTTATTCAGTAAACAAAGTCTGTCAGTTTCTTCATGCTCCTACTACCAGTCATTGGATTGCAGTAAAAAGAATCCTCAGATACTTGAACCAATGCACAAGTCTAGGACTTCATATACACAAGAGTGCTTCTACTCTTGTTCATGGGTATTCTGATGCAGACTGGGCAGGTAGTATAGATGACAGAAAATCAACAGGAGGATTTGCAGTATTTTTGGGTTCTAATCTTGTGTCCTGGAGTGCTAGGAAACAACCTACTGTGTCAAGGTCAAGCACAGAGGCAGAATATAAGGCTGTGGCAAATACTACAGCCGAACTGATATGGGTACAAACCTTGTTAAAAGAATTGGGAATTGAGTCTCCTAAAGCTGCCAAGATTTGGTGTGATAACTTAGGAGCTAAATATTTATCAGCTAATCCTGTGTTTCATGCAAGGACAAAGCATATAGAGGTTGATTATCATTTTGTAAGAGAACGAGTGTCACAGAAGCTGTTAGAGATTGATTTTGTTCCATCAGGAGACCAAGTTGCTGACGGGTTTACAAAGGCACTGTCAGCTTGTCTTCTTGAAAATTTTAAACACAATCTTAACCTAGCTAGGTTATGA


Protein sequences

Name Description Sequence
retrofit retrofit [Oryza longistaminata].

MASSSSSSGAAAANLLQGHSVSEKLGKANHALWKAQVSAAVRGARLLGYLNGDIKAPDAELSVTIDGKTTTKPNPAFEDWEANDQLVLGYLLSSLSRDVLIQVATCKTAAEAWRSIEALYSTGTRARAVNTRLALTNTKKGTMKIAEYVAKMRALGDEMAAGGHPLDEEDLVQYIIAGLNEDFSPIVSNLCNKSDPITVGELYSQLVNFETLLDLYRSTGQGGAAFVANRGRGGGGGGRGNNNNSGGGGGRSAPGGRGSGSQGRGGRGRGTGGQDRRPTCQVCFKRGHTAADCWYRFDEDYVADEKLVAAATNSYGIDTNWYIDTGATDHITGELEKLTTKEKYNGGEQIHTASGAGMDISHIGHTIVHTPSRNIHLNNVLYVPQAKKNLISASQLAADNSAFLELHSKFFSIKDQVTRDVLLEGKCRHGLYPIPKFFGRSTNKQALGAAKLSLSRWHSRLGHPSLPIVKQVISRNNLPCSVESVNQSVCNACQEAKSHQLPYIRSTSVSQFPLELVFSDVWGPAPESVGRNKYYVSFIDDFSKFTWIYLLKYKSEVFEKFKEFQALVERMFDRKIIAMQTDWRGGRYQKLNSFFAQIGLIIMCHVLTLIRQNGSAERKHRHIVEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTPLEKLFNQKPDYSSLRVFGCACWPHLRPYNTHKLQFRSKQCVFLGFSTHHKGFKCLDVSSGRVYISRDVVFDENVFPFSTLHSNAGARLRSEILLLPSPLTNYNTASAGGTHVVAPVANTPLPSDNLISNAADVTSGENSAAHEQEMENEQEIENVMHGNDVHGDAASGPVLDQPTADSSTAPDQGADTSDAVSGAASDAGGDTATLGAGAANSAAAGGEESQPVQPDVTGTVLATVAPASRPHTRLRSGIRKEKVYTDGTVKYGCFSSTGEPQNDKEALGDKNWRDAMETEYNALIKNDTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQNAFLHGFLEEEVYMQQPPGFESSSKPDYVCKLDKALYGLKQAPRAWYSRLSKKLVELGFEASKADTSLFFLNKGGILMFVLVYVDDIIVASSTEKATTALLKDLNKEFALKDLGDLHYFLGIEVTKVSNGVILTQEKYANDLLKRVNMSNCKPVSTPLSVSEKLTLYEGSPLGPNDAIQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAPTTSHWIAVKRILRYLNQCTSLGLHIHKSASTLVHGYSDADWAGSIDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTEAEYKAVANTTAELIWVQTLLKELGIESPKAAKIWCDNLGAKYLSANPVFHARTKHIEVDYHFVRERVSQKLLEIDFVPSGDQVADGFTKALSACLLENFKHNLNLARL

Domains

Domain Start-End Description Sequence

HMMPfam: PF14244
21-158 UBN2_3,gag-polypeptide of LTR copia-type

VSEKLGKANHALWKAQVSAAVRGARLLGYLNGDIKAPDAELSVTIDGKTTTKPNPAFEDWEANDQLVLGYLLSSLSRDVLIQVATCKTAAEAWRSIEALYSTGTRARAVNTRLALTNTKKGTMKIAEYVAKMRALGDE

HMMSmart: SM00343
IPR001878
279-295 ZnF_C2HC
Zinc finger, CCHC-type

TCQVCFKRGHTAADCWY

HMMPfam: PF13976
442-498 gag_pre-integrs,GAG-pre-integrase domain

TNKQALGAAKLSLSRWHSRLGHPSLPIVKQVISRNNLPCSVESVNQSVCNACQEAKS

superfamily: SSF53098
IPR012337
506-673 RNaseH_fold
Ribonuclease H-like domain

STSVSQFPLELVFSDVWGPAPESVGRNKYYVSFIDDFSKFTWIYLLKYKSEVFEKFKEFQALVERMFDRKIIAMQTDWRGGRYQKLNSFFAQIGLIIMCHVLTLIRQNGSAERKHRHIVEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTPLEKLFNQK

ProfileScan: PS50994
IPR001584
509-673 INTEGRASE
Integrase, catalytic core

VSQFPLELVFSDVWGPAPESVGRNKYYVSFIDDFSKFTWIYLLKYKSEVFEKFKEFQALVERMFDRKIIAMQTDWRGGRYQKLNSFFAQIGLIIMCHVLTLIRQNGSAERKHRHIVEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTPLEKLFNQK

Gene3D: G3DSA:3.30.420.10
512-665 G3DSA:3.30.420.10

FPLELVFSDVWGPAPESVGRNKYYVSFIDDFSKFTWIYLLKYKSEVFEKFKEFQALVERMFDRKIIAMQTDWRGGRYQKLNSFFAQIGLIIMCHVLTLIRQNGSAERKHRHIVEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTP

HMMPfam: PF00665
IPR001584
512-624 rve
Integrase, catalytic core

FPLELVFSDVWGPAPESVGRNKYYVSFIDDFSKFTWIYLLKYKSEVFEKFKEFQALVERMFDRKIIAMQTDWRGGRYQKLNSFFAQIGLIIMCHVLTLIRQNGSAERKHRHIV

HMMPanther: PTHR11439
570-1445 PTHR11439,GAG-POL-RELATED RETROTRANSPOSON

RMFDRKIIAMQTDWRGGRYQKLNSFFAQIGLIIMCHVLTLIRQNGSAERKHRHIVEVGLSLLSYASMPLKFWDEAFVAATYLINRIPSKTIQNSTPLEKLFNQKPDYSSLRVFGCACWPHLRPYNTHKLQFRSKQCVFLGFSTHHKGFKCLDVSSGRVYISRDVVFDENVFPFSTLHSNAGARLRSEILLLPSPLTNYNTASAGGTHVVAPVANTPLPSDNLISNAADVTSGENSAAHEQEMENEQEIENVMHGNDVHGDAASGPVLDQPTADSSTAPDQGADTSDAVSGAASDAGGDTATLGAGAANSAAAGGEESQPVQPDVTGTVLATVAPASRPHTRLRSGIRKEKVYTDGTVKYGCFSSTGEPQNDKEALGDKNWRDAMETEYNALIKNDTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQNAFLHGFLEEEVYMQQPPGFESSSKPDYVCKLDKALYGLKQAPRAWYSRLSKKLVELGFEASKADTSLFFLNKGGILMFVLVYVDDIIVASSTEKATTALLKDLNKEFALKDLGDLHYFLGIEVTKVSNGVILTQEKYANDLLKRVNMSNCKPVSTPLSVSEKLTLYEGSPLGPNDAIQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAPTTSHWIAVKRILRYLNQCTSLGLHIHKSASTLVHGYSDADWAGSIDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTEAEYKAVANTTAELIWVQTLLKELGIESPKAAKIWCDNLGAKYLSANPVFHARTKHIEVDYHFVRERVSQKLLEIDFVPSGDQVADGFTKALSACLLENFKHNLNLARL

superfamily: SSF56672
962-1400 SSF56672

KNDTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQNAFLHGFLEEEVYMQQPPGFESSSKPDYVCKLDKALYGLKQAPRAWYSRLSKKLVELGFEASKADTSLFFLNKGGILMFVLVYVDDIIVASSTEKATTALLKDLNKEFALKDLGDLHYFLGIEVTKVSNGVILTQEKYANDLLKRVNMSNCKPVSTPLSVSEKLTLYEGSPLGPNDAIQYRSIVGALQYLTLTRPDIAYSVNKVCQFLHAPTTSHWIAVKRILRYLNQCTSLGLHIHKSASTLVHGYSDADWAGSIDDRKSTGGFAVFLGSNLVSWSARKQPTVSRSSTEAEYKAVANTTAELIWVQTLLKELGIESPKAAKIWCDNLGAKYLSANPVFHARTKHIEVDYHFV

HMMPfam: PF07727
IPR013103
963-1206 RVT_2
Reverse transcriptase, RNA-dependent DNA polymeras

NDTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVAKGFKQRYGIDYEDTFSPVVKAATIRIILSIAVSRGWSLRQLDVQNAFLHGFLEEEVYMQQPPGFESSSKPDYVCKLDKALYGLKQAPRAWYSRLSKKLVELGFEASKADTSLFFLNKGGILMFVLVYVDDIIVASSTEKATTALLKDLNKEFALKDLGDLHYFLGIEVTKVSNGVILTQEKYANDLLKRVNMSNCKPVSTPLS


List of References

W Y Song, G L Wang, L L Chen, H S Kim, L Y Pi, T Holsten, J Gardner, B Wang, W X Zhai, L H Zhu, C Fauquet, P Ronald
A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21.
Science: 1995, 270(5243);1804-6
PubMed:8525370 WorldCat.org (P p)

W Y Song, L Y Pi, G L Wang, J Gardner, T Holsten, P C Ronald
Evolution of the rice Xa21 disease resistance gene family.
Plant Cell: 1997, 9(8);1279-87
PubMed:9286106 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox