PRGDB00049680 (gag/pol)

From PRG Wiki
Jump to: navigation, search
gag/pol
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2586078 (U72726)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza longistaminata

Comment?

Oryza longistaminata receptor kinase-like protein, family member D, and retrofit (gag/pol) genes, complete cds.

DNA Sequence

ATGATATCACTCCCATTATTGCTCTTCGTCCTGTTGTTCTCTGCGCTGCTGCTCTGCCCTTCAAGCAGTGACGACGATGGTGATGCTGCCGGCGACGAACTCGCGCTGCTCTCTTTCAAGTCATCCCTGCTATACCAGGGGGGCCAGTCGCTGGCATCTTGGAACACGTCCGGCCACGGCCAGCACTGCACATGGGTGGGTGTTGTGTGCGGCCGCCGCCGCCGCCGGCACCCACACAGGGTGGTGAAGCTGCTGCTGCGCTCCTCCAACCTGTCCGGGATCATCTCGCCGTCGCTCGGCAACCTGTCCTTCCTCAGGGAGCTGGACCTCGGCGACAACTACTTCTCCGGCGAGATACCACCGGAGCTCTGCCGTCTCAGCAGGCTTCAGCTGCTGGAGCTGAGCGATAACTCCATCCAAGGGAGCATCCCCGCGGCCATTGGAGCATGCACCAAGTTGACATCGCTAGACCTCAGCCACAACCAACTGCGAGGTATGATCCCACGTGAGATTGGTGCCAGCTTGAAACATCTCTCGAATTTGTACCTTCACAAAAATGGTTTGTCAGGAGAGATTCCATCCGCTTTGGGCAATCTCACTAGCCTCCAGGAGTTTGATTTGAGCTTCAACAGATTATCAGGAGCTATACCTTCATCACTGGGGCAGCTCAGCAGTCTATTGAATATGAATTTGGGACAGAACAATCTAAGTGGGATGATCCCCAATTCTATCTGGAACCTTTCGTCTCTAAGAGCGTTTTGTGTCAGCGAAAACAAGCTAGGTGGTATGATCCCTACAAATGCATTCAAAACCCTTCACCTCCTCGAGGTGATATATATGGGCACTAACCGTTTCCATGGCAAAATCCCTGCCTCAGTTGCTAATGCTTCTCATCTGACACGGCTTCAGATTGATGGCAACTTGTTCAGTGGAATTATCACCTCGGGGTTTGGAAGGTTAAGAAATCTCACAGAACTGTATCTCTGGAGAAATTTGTTTCAAACTAGAGAACAAGAAGATTGGGGGTTCATTTCTGACCTAACAAATTGCTCCAAATTACAAACATTGAACTTGGGAGAAAATAACCTGGGGGGAGTTCTTCCTAATTCGTTTTCCAATCTTTCCACTTCGCTTAGTTTTCTTGCACTTCATTTGAATAAGATCACAGGAAGCATTCCGCAAGATATTGGCAATCTTATTGGCTTACAACATCTCTATCTCTGCAACAACAATTTCAGAGGGTCTCTTCCATCATCGTTGGGCAGGCTTAAAAACTTAGGCATTCTACTCGCCTACGAAAACAACTTGAGCGGTTCGATCCCGTTGGCCATAGGAAATCTTACTGAACTTAATATCTTACTGCTCGGCACCAACAAATTCAGTGGTTGGATACCATACACACTCTCAAACCTCACAAACTTGTTGTCATTAGGCCTTTCAACTAATAACCTTAGTGGTCCAATACCCAGTGAATTATTCAATATTCAAACACTATCAATAATGATCAATGTATCAAAAAATAACTTGGAGGGATCAATACCACAAGAAATAGGGCATCTCAAAAATCTAGTAGAATTTCATGCAGAATCGAATAGATTATCAGGTAAAATCCCTAACACGCTTGGTGATTGCCAGCTCTTACGGCATCTTTATCTGCAAAATAATTTGTTATCTGGTAGCATCCCATCAGCCTTGGGTCAGCTGAAAGGTCTCGAAACTCTTGATCTCTCAAGCAACAATTTGTCAGGCCAGATACCCACATCCTTAGCAGATATTACTATGCTTCATTCCTTGAACCTTTCTTTCAACAGCTTTGTGGGGGAAGTGCCAACCATGTGA


Protein sequences

Name Description Sequence
receptor kinase-like protein receptor kinase-like protein [Oryza longistaminata].

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYFSGEIPPELCRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLHKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLNMNLGQNNLSGMIPNSIWNLSSLRAFCVSENKLGGMIPTNAFKTLHLLEVIYMGTNRFHGKIPASVANASHLTRLQIDGNLFSGIITSGFGRLRNLTELYLWRNLFQTREQEDWGFISDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALHLNKITGSIPQDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRHLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVPTM


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-610 PTHR24420,FAMILY NOT NAMED

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYFSGEIPPELCRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLHKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLNMNLGQNNLSGMIPNSIWNLSSLRAFCVSENKLGGMIPTNAFKTLHLLEVIYMGTNRFHGKIPASVANASHLTRLQIDGNLFSGIITSGFGRLRNLTELYLWRNLFQTREQEDWGFISDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALHLNKITGSIPQDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRHLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVP

HMMPanther: PTHR24420:SF474
1-610 PTHR24420:SF474,SUBFAMILY NOT NAMED

MISLPLLLFVLLFSALLLCPSSSDDDGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYFSGEIPPELCRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLHKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLNMNLGQNNLSGMIPNSIWNLSSLRAFCVSENKLGGMIPTNAFKTLHLLEVIYMGTNRFHGKIPASVANASHLTRLQIDGNLFSGIITSGFGRLRNLTELYLWRNLFQTREQEDWGFISDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALHLNKITGSIPQDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRHLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVP

superfamily: SSF52058
26-333 SSF52058,LRR

DGDAAGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYFSGEIPPELCRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLHKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLNMNLGQNNLSGMIPNSIWNLSSLRAFCVSENKLGGMIPTNAFKTLHLLEVIYMGTNRFHGKIPASVANASHLTRLQIDGNLFSGIITSGFGRLRNLTELYLWRNLF

HMMPfam: PF08263
IPR013210
30-70 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

AGDELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVC

Gene3D: G3DSA:3.80.10.10
32-334 G3DSA:3.80.10.10

DELALLSFKSSLLYQGGQSLASWNTSGHGQHCTWVGVVCGRRRRRHPHRVVKLLLRSSNLSGIISPSLGNLSFLRELDLGDNYFSGEIPPELCRLSRLQLLELSDNSIQGSIPAAIGACTKLTSLDLSHNQLRGMIPREIGASLKHLSNLYLHKNGLSGEIPSALGNLTSLQEFDLSFNRLSGAIPSSLGQLSSLLNMNLGQNNLSGMIPNSIWNLSSLRAFCVSENKLGGMIPTNAFKTLHLLEVIYMGTNRFHGKIPASVANASHLTRLQIDGNLFSGIITSGFGRLRNLTELYLWRNLFQ

HMMPfam: PF00560
IPR001611
105-126 LRR_1
Leucine-rich repeat

LRELDLGDNYFSGEIPPELCRL

HMMPfam: PF13855
152-212 LRR_8,Leucine rich repeat

KLTSLDLSHNQLRGMIPREIGASLKHLSNLYLHKNGLSGEIPSALGNLTSLQEFDLSFNRL

FPrintScan: PR00019
153-166 LEURICHRPT,Leucine-rich repeat signature

LTSLDLSHNQLRGM

superfamily: SSF52058
345-610 SSF52058,LRR

SDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALHLNKITGSIPQDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLSIMINVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRHLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVP

Gene3D: G3DSA:3.80.10.10
345-499 G3DSA:3.80.10.10

SDLTNCSKLQTLNLGENNLGGVLPNSFSNLSTSLSFLALHLNKITGSIPQDIGNLIGLQHLYLCNNNFRGSLPSSLGRLKNLGILLAYENNLSGSIPLAIGNLTELNILLLGTNKFSGWIPYTLSNLTNLLSLGLSTNNLSGPIPSELFNIQTLS

HMMPfam: PF00560
IPR001611
352-374 LRR_1
Leucine-rich repeat

KLQTLNLGENNLGGVLPNSFSNL

HMMPfam: PF00560
IPR001611
402-423 LRR_1
Leucine-rich repeat

LQHLYLCNNNFRGSLPSSLGRL

Gene3D: G3DSA:3.80.10.10
503-610 G3DSA:3.80.10.10

NVSKNNLEGSIPQEIGHLKNLVEFHAESNRLSGKIPNTLGDCQLLRHLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNSFVGEVP

HMMPfam: PF13855
546-604 LRR_8,Leucine rich repeat

LLRHLYLQNNLLSGSIPSALGQLKGLETLDLSSNNLSGQIPTSLADITMLHSLNLSFNS

FPrintScan: PR00019
568-581 LEURICHRPT,Leucine-rich repeat signature

LKGLETLDLSSNNL


List of References

W Y Song, G L Wang, L L Chen, H S Kim, L Y Pi, T Holsten, J Gardner, B Wang, W X Zhai, L H Zhu, C Fauquet, P Ronald
A receptor kinase-like protein encoded by the rice disease resistance gene, Xa21.
Science: 1995, 270(5243);1804-6
PubMed:8525370 WorldCat.org (P p)

W Y Song, L Y Pi, G L Wang, J Gardner, T Holsten, P C Ronald
Evolution of the rice Xa21 disease resistance gene family.
Plant Cell: 1997, 9(8);1279-87
PubMed:9286106 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox