PRGDB00049681 (RPS2)

From PRG Wiki
Jump to: navigation, search
RPS2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 549978 (U12860)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Col-0 resistance to Pseudomonas syringae (RPS2) mRNA, complete cds.

DNA Sequence

ATGGATTTCATCTCATCTCTTATCGTTGGCTGTGCTCAGGTGTTGTGTGAATCTATGAATATGGCGGAGAGAAGAGGACATAAGACTGATCTTAGACAAGCCATCACTGATCTTGAAACAGCCATCGGTGACTTGAAGGCCATACGTGATGACCTGACTTTACGGATCCAACAAGACGGTCTAGAGGGACGAAGCTGCTCAAATCGTGCCAGAGAGTGGCTTAGTGCGGTGCAAGTAACGGAGACTAAAACAGCCCTACTTTTAGTGAGGTTTAGGCGTCGGGAACAGAGGACGCGAATGAGGAGGAGATACCTCAGTTGTTTCGGTTGTGCCGACTACAAACTGTGCAAGAAGGTTTCTGCCATATTGAAGAGCATTGGTGAGCTGAGAGAACGCTCTGAAGCTATCAAAACAGATGGCGGGTCAATTCAAGTAACTTGTAGAGAGATACCCATCAAGTCCGTTGTCGGAAATACCACGATGATGGAACAGGTTTTGGAATTTCTCAGTGAAGAAGAAGAAAGAGGAATCATTGGTGTTTATGGACCTGGTGGGGTTGGGAAGACAACGTTAATGCAGAGCATTAACAACGAGCTGATCACAAAAGGACATCAGTATGATGTACTGATTTGGGTTCAAATGTCCAGAGAATTCGGCGAGTGTACAATTCAGCAAGCCGTTGGAGCACGGTTGGGTTTATCTTGGGACGAGAAGGAGACCGGCGAAAACAGAGCTTTGAAGATATACAGAGCTTTGAGACAGAAACGTTTCTTGTTGTTGCTAGATGATGTCTGGGAAGAGATAGACTTGGAGAAAACTGGAGTTCCTCGACCTGACAGGGAAAACAAATGCAAGGTGATGTTCACGACACGGTCTATAGCATTATGCAACAATATGGGTGCGGAATACAAGTTGAGAGTGGAGTTTCTGGAGAAGAAACACGCGTGGGAGCTGTTCTGTAGTAAGGTATGGAGAAAAGATCTTTTAGAGTCATCATCAATTCGCCGGCTCGCGGAGATTATAGTGAGTAAATGTGGAGGATTGCCACTAGCGTTGATCACTTTAGGAGGAGCCATGGCTCATAGAGAGACAGAAGAAGAGTGGATCCATGCTAGTGAAGTTCTGACTAGATTTCCAGCAGAGATGAAGGGTATGAACTATGTATTTGCCCTTTTGAAATTCAGCTACGACAACCTCGAGAGTGATCTGCTTCGGTCTTGTTTCTTGTACTGCGCTTTATTCCCAGAAGAACATTCTATAGAGATCGAGCAGCTTGTTGAGTACTGGGTCGGCGAAGGGTTTCTCACCAGCTCCCATGGCGTTAACACCATTTACAAGGGATATTTTCTCATTGGGGATCTGAAAGCGGCATGTTTGTTGGAAACCGGAGATGAGAAAACACAGGTGAAGATGCATAATGTGGTCAGAAGCTTTGCATTGTGGATGGCATCTGAACAGGGGACTTATAAGGAGCTGATCCTAGTTGAGCCTAGCATGGGACATACTGAAGCTCCTAAAGCAGAAAACTGGCGACAAGCGTTGGTGATCTCATTGTTAGATAACAGAATCCAGACCTTGCCTGAAAAACTCATATGCCCGAAACTGACAACACTGATGCTCCAACAGAACAGCTCTTTGAAGAAGATTCCAACAGGGTTTTTCATGCATATGCCTGTTCTCAGAGTCTTGGACTTGTCGTTCACAAGTATCACTGAGATTCCGTTGTCTATCAAGTATTTGGTGGAGTTGTATCATCTGTCTATGTCAGGAACAAAGATAAGTGTATTGCCACAGGAGCTTGGGAATCTTAGAAAACTGAAGCATCTGGACCTACAAAGAACTCAGTTTCTTCAGACGATCCCACGAGATGCCATATGTTGGCTGAGCAAGCTCGAGGTTCTGAACTTGTACTACAGTTACGCCGGTTGGGAACTGCAGAGCTTTGGAGAAGATGAAGCAGAAGAACTCGGATTCGCTGACTTGGAATACTTGGAAAACCTAACCACACTCGGTATCACTGTTCTCTCATTGGAGACCCTAAAAACTCTCTTCGAGTTCGGTGCTTTGCATAAACATATACAGCATCTCCACGTTGAAGAGTGCAATGAACTCCTCTACTTCAATCTCCCATCACTCACTAACCATGGCAGGAACCTGAGAAGACTTAGCATTAAAAGTTGCCATGACTTGGAGTACCTGGTCACACCCGCAGATTTTGAAAATGATTGGCTTCCGAGTCTAGAGGTTCTGACGTTACACAGCCTTCACAACTTAACCAGAGTGTGGGGAAATTCTGTAAGCCAAGATTGTCTGCGGAATATCCGTTGCATAAACATTTCACACTGCAACAAGCTGAAGAATGTCTCATGGGTTCAGAAACTCCCAAAGCTAGAGGTGATTGAACTGTTCGACTGCAGAGAGATAGAGGAATTGATAAGCGAACACGAGAGTCCATCCGTCGAAGATCCAACATTGTTCCCAAGCCTGAAGACCTTGAGAACTAGGGATCTGCCAGAACTAAACAGCATCCTCCCATCTCGATTTTCATTCCAAAAAGTTGAAACATTAGTCATCACAAATTGCCCCAGAGTTAAGAAACTGCCGTTTCAGGAGAGGAGGACCCAGATGAACTTGCCAACAGTTTATTGTGAGGAGAAATGGTGGAAAGCACTGGAAAAAGATCAACCAAACGAAGAGCTTTGTTATTTACCGCGCTTTGTTCCAAATTGA



Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
13-909 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QVLCESMNMAERRGHKTDLRQAITDLETAIGDLKAIRDDLTLRIQQDGLEGRSCSNRAREWLSAVQVTETKTALLLVRFRRREQRTRMRRRYLSCFGCADYKLCKKVSAILKSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHSIEIEQLVEYWVGEGFLTSSHGVNTIYKGYFLIGDLKAACLLETGDEKTQVKMHNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNELLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLRTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCEEKWWKALEKDQPNEELCYLPRFVPN

HMMPanther: PTHR23155:SF105
13-909 PTHR23155:SF105,RPS2 (RESISTANT TO P. SYRINGAE 2)

QVLCESMNMAERRGHKTDLRQAITDLETAIGDLKAIRDDLTLRIQQDGLEGRSCSNRAREWLSAVQVTETKTALLLVRFRRREQRTRMRRRYLSCFGCADYKLCKKVSAILKSIGELRERSEAIKTDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHSIEIEQLVEYWVGEGFLTSSHGVNTIYKGYFLIGDLKAACLLETGDEKTQVKMHNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNELLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLRTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCEEKWWKALEKDQPNEELCYLPRFVPN

superfamily: SSF52540
138-382 SSF52540

TDGGSIQVTCREIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEM

Gene3D: G3DSA:3.40.50.300
148-265 G3DSA:3.40.50.300

REIPIKSVVGNTTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVW

HMMPfam: PF00931
IPR002182
159-439 NB-ARC,NBS
NB-ARC

TTMMEQVLEFLSEEEERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLEKKHAWELFCSKVWRKDLLESSSIRRLAEIIVSKCGGLPLALITLGGAMAHRETEEEWIHASEVLTRFPAEMKGMNYVFALLKFSYDNLESDLLRSCFLYCALFPEEHSIEIEQLVEYWVGEGFLTSSH

HMMSmart: SM00382
IPR003593
174-311 AAA,NBS
AAA+ ATPase domain

ERGIIGVYGPGGVGKTTLMQSINNELITKGHQYDVLIWVQMSREFGECTIQQAVGARLGLSWDEKETGENRALKIYRALRQKRFLLLLDDVWEEIDLEKTGVPRPDRENKCKVMFTTRSIALCNNMGAEYKLRVEFLE

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

IIGVYGPGGVGKTTLM

FPrintScan: PR00364
IPR000767
251-265 DISEASERSIST
Disease resistance protein

ALRQKRFLLLLDDVW

FPrintScan: PR00364
IPR000767
345-359 DISEASERSIST
Disease resistance protein

CGGLPLALITLGGAM

superfamily: SSF52058
470-884 SSF52058,LRR

KMHNVVRSFALWMASEQGTYKELILVEPSMGHTEAPKAENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYYSYAGWELQSFGEDEAEELGFADLEYLENLTTLGITVLSLETLKTLFEFGALHKHIQHLHVEECNELLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLRTRDLPELNSILPSRFSFQKVETLVITNCPRVKKLPFQERRTQMNLPTVYCE

Gene3D: G3DSA:3.80.10.10
508-638 G3DSA:3.80.10.10

ENWRQALVISLLDNRIQTLPEKLICPKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKISVLPQELGNLRKLKHLDLQRTQFLQTIPRDAICWLSKLEVLNLYY

HMMPfam: PF13855
533-593 LRR_8,Leucine rich repeat

PKLTTLMLQQNSSLKKIPTGFFMHMPVLRVLDLSFTSITEIPLSIKYLVELYHLSMSGTKI

FPrintScan: PR00364
IPR000767
601-617 DISEASERSIST
Disease resistance protein

GNLRKLKHLDLQRTQFL

Gene3D: G3DSA:3.80.10.10
681-864 G3DSA:3.80.10.10

KTLFEFGALHKHIQHLHVEECNELLYFNLPSLTNHGRNLRRLSIKSCHDLEYLVTPADFENDWLPSLEVLTLHSLHNLTRVWGNSVSQDCLRNIRCINISHCNKLKNVSWVQKLPKLEVIELFDCREIEELISEHESPSVEDPTLFPSLKTLRTRDLPELNSILPSRFSFQKVETLVITNCPRV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox