PRGDB00049682 (Casein kinase I isoform delta-like)

From PRG Wiki
Jump to: navigation, search
Casein kinase I isoform delta-like
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank
Gene Class Unknown
Domain Type Receptor-Like Kinase, Receptor-Like Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

DNA Sequence

ATGGAACCTCGTGTGGGGAACAAGTTTCGTCTCGGCCGAAAGATCGGTAGTGGTTCGTTTGGAGAGATCTATCTCGGTACTAATATTCATACGAATGAAGAACTGGCTATTAAGCTTGAAAATGTGAAGACAAAACATCCACAGCTGCTCTATGAATCGAAGTTATACAGGATTCTACAAGGGGGAACTGGTGTTCCAAATGTCAAATGGTTTGGTGTTGAAGGGGACTATAATGTTTTGGTGATGGATCTACTCGGACCAAGTCTTGAAGATCTCTTCAATTTTTGTAGCAGGAAACTTTCATTGAAGTCTGTCCTCATGCTTGCTGATCAAATGATCAACCGTGTTGAGTTTTTTCATTCAAAGTCTTTCCTTCACCGAGATCTTAAGCCAGACAACTTCCTCATGGGCCTTGGAAGGCGTGCGAACCAGGTATACATCATTGACTTTGGTCTTGCTAAGAAGTATAGGGATAGTACAACACATCAGCACATTCCCTACAGGGAAAATAAAAACCTGACAGGAACTGCGAGATATGCTAGTATGAACACTCACTTGGGAATTGAACAAAGTCGAAGGGATGATCTTGAGTCTCTTGGTTACATCCTTATGTATTTCCTCAAAGGAAGTCTTCCATGGCAAGGACTGAAAGCTGGAACCAAAAAGCAAAAGTATGAAAGGATTAGTGAAAAGAAAGTTTCTACATCCATTGAGGCTTTATGTCGTGGTTACCCATCCGAATTTGCATCCTATTTCCACTACTGTCGGTCGCTTCGGTTTGATGATAAACCAGATTACGCTTATCTGAAAAGAATATTTCGAGATCTCTTTATCCGTGAAGGGTTTCAGTTTGATTACGTGTTTGACTGGACAATCTTGAAATATCAACAATCACAACTAACCGCTCCCCCATCTCGTGCCCTCAATCCTGCTGTGGGAACTAGTGCCGCATTGCCTCCGGGCATTTCCAACATCGATAGATACACAGGGGAGGAAGAAGGGCGACCACATATGGAATCATCTCGACGGAGAGTTTCAGGGGCTCTTGATAACTCAGGGAATATTTCGAACCAACCGACATCCTCAAGTGCTAGAGACTCCATGATCCCGAGCTCCTCGTTGTTTGCACAATCAGCAGGATCATCGAGGAGAGTAACTGCAGTAAGTGGCAGCCGGGACAATTTTCCAGGCAGCGAGGAGTTGTTGCAGAGAAGCCGTACAGGTGACGTCAGCCGCGGCGTGATCCCGAGAAACTCTCCTGGGGAGGCTGGGAAATCCACAAGAAGACACTACGAATCAGTAGTTAAAGGCATCGATAATCTTCAAGTCTCGGACGAACACCATCCCCACTGA


Protein sequences

Name Description Sequence
Casein kinase I isoform delta-like RecName: Full=Casein kinase I isoform delta-like; Short=CKI-delta.

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHMESSRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGSRDNFPGSEELLQRSRTGDVSRGVIPRNSPGEAGKSTRRHYESVVKGIDNLQVSDEHHPH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11909
1-433 FAMILY NOT NAMED,CASEIN KINASE-RELATED

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHMESSRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGSRDNFPGSEELLQRSRTGDVSRGVIPRNSPGEAGKSTRRHYES

HMMPanther: PTHR11909:SF18
1-433 CASEIN KINASE,CASEIN KINASE

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHMESSRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGSRDNFPGSEELLQRSRTGDVSRGVIPRNSPGEAGKSTRRHYES

superfamily: SSF56112
IPR011009
5-290 Protein kinase-like (PK-like)
Protein kinase-like domain

VGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDW

HMMPfam: PF00069
IPR000719
9-244 Pkinase,Ser-thr
Protein kinase, catalytic domain

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGY

HMMSmart: SM00220
IPR002290
9-287 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYV

ProfileScan: PS50011
IPR000719
9-278 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFI

Gene3D: G3DSA:3.30.200.20
12-79 no description

GRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNV

PatternScan: PS00107
IPR017441
15-38 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGSFGEIYLGTNIHTNEELAIK

Gene3D: G3DSA:1.10.510.10
80-276 no description

LVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDL

PatternScan: PS00108
IPR008271
124-136 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FLHRDLKPDNFLM

Seg: seg
371-382 seg

SSSLFAQSAGSS


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox