PRGDB00049682 (Casein kinase I isoform delta-like)

From PRG Wiki
Jump to: navigation, search
Casein kinase I isoform delta-like
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank
Gene Class Unknown
Domain Type Receptor-Like Kinase, Receptor-Like Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

DNA Sequence

ATGGAACCTCGTGTGGGGAACAAGTTTCGTCTCGGCCGAAAGATCGGTAGTGGTTCGTTTGGAGAGATCTATCTCGGTACTAATATTCATACGAATGAAGAACTGGCTATTAAGCTTGAAAATGTGAAGACAAAACATCCACAGCTGCTCTATGAATCGAAGTTATACAGGATTCTACAAGGGGGAACTGGTGTTCCAAATGTCAAATGGTTTGGTGTTGAAGGGGACTATAATGTTTTGGTGATGGATCTACTCGGACCAAGTCTTGAAGATCTCTTCAATTTTTGTAGCAGGAAACTTTCATTGAAGTCTGTCCTCATGCTTGCTGATCAAATGATCAACCGTGTTGAGTTTTTTCATTCAAAGTCTTTCCTTCACCGAGATCTTAAGCCAGACAACTTCCTCATGGGCCTTGGAAGGCGTGCGAACCAGGTATACATCATTGACTTTGGTCTTGCTAAGAAGTATAGGGATAGTACAACACATCAGCACATTCCCTACAGGGAAAATAAAAACCTGACAGGAACTGCGAGATATGCTAGTATGAACACTCACTTGGGAATTGAACAAAGTCGAAGGGATGATCTTGAGTCTCTTGGTTACATCCTTATGTATTTCCTCAAAGGAAGTCTTCCATGGCAAGGACTGAAAGCTGGAACCAAAAAGCAAAAGTATGAAAGGATTAGTGAAAAGAAAGTTTCTACATCCATTGAGGCTTTATGTCGTGGTTACCCATCCGAATTTGCATCCTATTTCCACTACTGTCGGTCGCTTCGGTTTGATGATAAACCAGATTACGCTTATCTGAAAAGAATATTTCGAGATCTCTTTATCCGTGAAGGGTTTCAGTTTGATTACGTGTTTGACTGGACAATCTTGAAATATCAACAATCACAACTAACCGCTCCCCCATCTCGTGCCCTCAATCCTGCTGTGGGAACTAGTGCCGCATTGCCTCCGGGCATTTCCAACATCGATAGATACACAGGGGAGGAAGAAGGGCGACCACATATGGAATCATCTCGACGGAGAGTTTCAGGGGCTCTTGATAACTCAGGGAATATTTCGAACCAACCGACATCCTCAAGTGCTAGAGACTCCATGATCCCGAGCTCCTCGTTGTTTGCACAATCAGCAGGATCATCGAGGAGAGTAACTGCAGTAAGTGGCAGCCGGGACAATTTTCCAGGCAGCGAGGAGTTGTTGCAGAGAAGCCGTACAGGTGACGTCAGCCGCGGCGTGATCCCGAGAAACTCTCCTGGGGAGGCTGGGAAATCCACAAGAAGACACTACGAATCAGTAGTTAAAGGCATCGATAATCTTCAAGTCTCGGACGAACACCATCCCCACTGA


Protein sequences

Name Description Sequence
Casein kinase I isoform delta-like RecName: Full=Casein kinase I isoform delta-like; Short=CKI-delta.

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHMESSRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGSRDNFPGSEELLQRSRTGDVSRGVIPRNSPGEAGKSTRRHYESVVKGIDNLQVSDEHHPH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11909
1-433 FAMILY NOT NAMED,CASEIN KINASE-RELATED

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHMESSRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGSRDNFPGSEELLQRSRTGDVSRGVIPRNSPGEAGKSTRRHYES

HMMPanther: PTHR11909:SF18
1-433 CASEIN KINASE,CASEIN KINASE

MEPRVGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDWTILKYQQSQLTAPPSRALNPAVGTSAALPPGISNIDRYTGEEEGRPHMESSRRRVSGALDNSGNISNQPTSSSARDSMIPSSSLFAQSAGSSRRVTAVSGSRDNFPGSEELLQRSRTGDVSRGVIPRNSPGEAGKSTRRHYES

superfamily: SSF56112
IPR011009
5-290 Protein kinase-like (PK-like)
Protein kinase-like domain

VGNKFRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYVFDW

HMMPfam: PF00069
IPR000719
9-244 Pkinase,Ser-thr
Protein kinase, catalytic domain

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGY

HMMSmart: SM00220
IPR002290
9-287 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFIREGFQFDYV

ProfileScan: PS50011
IPR000719
9-278 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRLGRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLFI

Gene3D: G3DSA:3.30.200.20
12-79 no description

GRKIGSGSFGEIYLGTNIHTNEELAIKLENVKTKHPQLLYESKLYRILQGGTGVPNVKWFGVEGDYNV

PatternScan: PS00107
IPR017441
15-38 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGSGSFGEIYLGTNIHTNEELAIK

Gene3D: G3DSA:1.10.510.10
80-276 no description

LVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQVYIIDFGLAKKYRDSTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDL

PatternScan: PS00108
IPR008271
124-136 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FLHRDLKPDNFLM

Seg: seg
371-382 seg

SSSLFAQSAGSS


List of References

M Mindrinos, F Katagiri, G L Yu, F M Ausubel
The A. thaliana disease resistance gene RPS2 encodes a protein containing a nucleotide-binding site and leucine-rich repeats.
Cell: 1994, 78(6);1089-99
PubMed:7923358 WorldCat.org (P p)

K Mayer, C Schüller, R Wambutt, G Murphy, G Volckaert, T Pohl, A Düsterhöft, W Stiekema, K D Entian, N Terryn, B Harris, W Ansorge, P Brandt, L Grivell, M Rieger, M Weichselgartner, V de Simone, B Obermaier, R Mache, M Müller, M Kreis, M Delseny, P Puigdomenech, M Watson, T Schmidtheini, B Reichert, D Portatelle, M Perez-Alonso, M Boutry, I Bancroft, P Vos, J Hoheisel, W Zimmermann, H Wedler, P Ridley, S A Langham, B McCullagh, L Bilham, J Robben, J Van der Schueren, B Grymonprez, Y J Chuang, F Vandenbussche, M Braeken, I Weltjens, M Voet, I Bastiaens, R Aert, E Defoor, T Weitzenegger, G Bothe, U Ramsperger, H Hilbert, M Braun, E Holzer, A Brandt, S Peters, M van Staveren, W Dirske, P Mooijman, R Klein Lankhorst, M Rose, J Hauf, P Kötter, S Berneiser, S Hempel, M Feldpausch, S Lamberth, H Van den Daele, A De Keyser, C Buysshaert, J Gielen, R Villarroel, R De Clercq, M Van Montagu, J Rogers, A Cronin, M Quail, S Bray-Allen, L Clark, J Doggett, S Hall, M Kay, N Lennard, K McLay, R Mayes, A Pettett, M A Rajandream, M Lyne, V Benes, S Rechmann, D Borkova, H Blöcker, M Scharfe, M Grimm, T H Löhnert, S Dose, M de Haan, A Maarse, M Schäfer, S Müller-Auer, C Gabel, M Fuchs, B Fartmann, K Granderath, D Dauner, A Herzl, S Neumann, A Argiriou, D Vitale, R Liguori, E Piravandi, O Massenet, F Quigley, G Clabauld, A Mündlein, R Felber, S Schnabl, R Hiller, W Schmidt, A Lecharny, S Aubourg, F Chefdor, R Cooke, C Berger, A Montfort, E Casacuberta, T Gibbons, N Weber, M Vandenbol, M Bargues, J Terol, A Torres, A Perez-Perez, B Purnelle, E Bent, S Johnson, D Tacon, T Jesse, L Heijnen, S Schwarz, P Scholler, S Heber, P Francs, C Bielke, D Frishman, D Haase, K Lemcke, H W Mewes, S Stocker, P Zaccaria, M Bevan, R K Wilson, M de la Bastide, K Habermann, L Parnell, N Dedhia, L Gnoj, K Schutz, E Huang, L Spiegel, M Sehkon, J Murray, P Sheet, M Cordes, J Abu-Threideh, T Stoneking, J Kalicki, T Graves, G Harmon, J Edwards, P Latreille, L Courtney, J Cloud, A Abbott, K Scott, D Johnson, P Minx, D Bentley, B Fulton, N Miller, T Greco, K Kemp, J Kramer, L Fulton, E Mardis, M Dante, K Pepin, L Hillier, J Nelson, J Spieth, E Ryan, S Andrews, C Geisel, D Layman, H Du, J Ali, A Berghoff, K Jones, K Drone, M Cotton, C Joshu, B Antonoiu, M Zidanic, C Strong, H Sun, B Lamar, C Yordan, P Ma, J Zhong, R Preston, D Vil, M Shekher, A Matero, R Shah, I K Swaby, A O'Shaughnessy, M Rodriguez, J Hoffmann, S Till, S Granat, N Shohdy, A Hasegawa, A Hameed, M Lodhi, A Johnson, E Chen, M Marra, R Martienssen, W R McCombie
Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.
Nature: 1999, 402(6763);769-77
PubMed:10617198 WorldCat.org DOI (P p)

Kayoko Yamada, Jun Lim, Joseph M Dale, Huaming Chen, Paul Shinn, Curtis J Palm, Audrey M Southwick, Hank C Wu, Christopher Kim, Michelle Nguyen, Paul Pham, Rosa Cheuk, George Karlin-Newmann, Shirley X Liu, Bao Lam, Hitomi Sakano, Troy Wu, Guixia Yu, Molly Miranda, Hong L Quach, Matthew Tripp, Charlie H Chang, Jeong M Lee, Mitsue Toriumi, Marie M H Chan, Carolyn C Tang, Courtney S Onodera, Justine M Deng, Kenji Akiyama, Yasser Ansari, Takahiro Arakawa, Jenny Banh, Fumika Banno, Leah Bowser, Shelise Brooks, Piero Carninci, Qimin Chao, Nathan Choy, Akiko Enju, Andrew D Goldsmith, Mani Gurjal, Nancy F Hansen, Yoshihide Hayashizaki, Chanda Johnson-Hopson, Vickie W Hsuan, Kei Iida, Meagan Karnes, Shehnaz Khan, Eric Koesema, Junko Ishida, Paul X Jiang, Ted Jones, Jun Kawai, Asako Kamiya, Cristina Meyers, Maiko Nakajima, Mari Narusaka, Motoaki Seki, Tetsuya Sakurai, Masakazu Satou, Racquel Tamse, Maria Vaysberg, Erika K Wallender, Cecilia Wong, Yuki Yamamura, Shiaulou Yuan, Kazuo Shinozaki, Ronald W Davis, Athanasios Theologis, Joseph R Ecker
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science: 2003, 302(5646);842-6
PubMed:14593172 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox