PRGDB00049684 (RPW8.2)

From PRG Wiki
Jump to: navigation, search
RPW8.2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 216263248 (FJ267630)
Gene Class Other
Domain Type RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana haplotype Th9 RPW8.2 (RPW8.2) gene, complete cds.

DNA Sequence

ATGATTGCTGAGGTTGCCGCAGGGGGTGCTCTTGGACTTGCTCTCAGTGTCCTCCACGAGGCCGTCAAAAGAGCAAAAGATAGATCTGTAACCACAAGATTCATCTTACACCGTCTCGAAGCTACAATCGATAGTATCACACCGTTGGTGGTTCAAATTGATAAGTTCAGTGAAGAAATGGAAGATTCATCATCGAGGAAAGTCAATAAACGTCTTAAGCTTCTCCTTGAGAACGCTGTTTCTCTTGTTGAGGAGAATGCGGAGCTGAGACGCAGAAACGTACGCAAGAAGTTCAGGTACATGAGAGATATCAAAGAGTTCGAAGCTAAATTACGATGGGTTGTAGGTGTGGATGTTCAAGTTAATCAATTGGCWGATATCAAAGAACTCAAGGCCAAGATGTCTGAAATCAGGACTAAATTTGACTCAACCAGCTGA


Protein sequences

Name Description Sequence
RPW8.2 RPW8.2 [Arabidopsis thaliana].

MIAEVAAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSSSRKVNKRLKLLLENAVSLVEENAELRRRNVRKKFRYMRDIKEFEAKLRWVVGVDVQVNQLADIKELKAKMSEIRTKFDSTS

Domains

Domain Start-End Description Sequence

HMMPfam: PF05659
IPR008808
1-143 RPW8
Powdery mildew resistance protein, RPW8 domain

MIAEVAAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSSSRKVNKRLKLLLENAVSLVEENAELRRRNVRKKFRYMRDIKEFEAKLRWVVGVDVQVNQLADIKELKAKMSEIRTKFDS

ProfileScan: PS51153
IPR008808
1-145 RPW8
Powdery mildew resistance protein, RPW8 domain

MIAEVAAGGALGLALSVLHEAVKRAKDRSVTTRFILHRLEATIDSITPLVVQIDKFSEEMEDSSSRKVNKRLKLLLENAVSLVEENAELRRRNVRKKFRYMRDIKEFEAKLRWVVGVDVQVNQLADIKELKAKMSEIRTKFDSTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox