PRGDB00049708 (unnamed protein product [Oryza sativa Japonica Group].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Oryza sativa Japonica Group].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32987742 (AK102533)
Gene Class RLP
Domain Type LRR, LRR, LRR, Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cDNA clone:J033096F04, full insert sequence.

DNA Sequence

ATGTCGTCCCCAATTGCCATTGGTCGTCGACACGGGCCACCACCACTGCTACTACACCTGCTCATCCTTCATCTCCTGTTAGGCTTCCAACACCTCTGCTACTCCCTTGCCACGTACAGCAACCGAAGTACTGCTGCCATGCCGGCCCCGTGCTTGCCCGACCAGGCAGCGGCGCTGCTCCGCCTGAAACATTCCTTCAACATGACCAACAAGTCCGAGTGCACCCTCGCATCATGGCGCGCCGGCACGGACTGCTGCCGCTGGGAGGGCGTCCGCTGCGGCGTCGGCATCGGCGTTGGCCATGTGACCTCGCTTGACCTCGGTGAGTGCGGATTGGAGAGCGCTGCTCTTGACCCTGCGCTTTTCGAGCTCACTTCGCTCAGGCACCTTAACCTCGCGTGGAACAATTTCAGCGGGTCTCATATTCCCACCATTGGGTTCGAACGGCTCACTGAGCTCACCTACCTCAATCTCTCCAACTCCAAATTTGCAGGCCAGATACCAAATACAATAGGACGTCTCACTAATTTGATATCCCTTGACCTCTCCACTGATTTTTTCCTTATTGATCTAGATGATGAGTTCTTATCAGTTGCCACCTATTCACCCGCTTGGTTACTTGTGGCACCAAACATTGTGTCAATAGTCGCAAACCTCCACAACCTGAAGGAACTTTATATGGGCACAATAGACTTGTCCAGCAACAGCATGGTACAGTGGTGCAGTGCCTTTTCAAACTCCACTACCCCTCAACTTCAGGTCCTTAGCTTACCATATTGCTACCTCGAGGTTCCCATTTGTGAATCATTGTCGGGTATACGCTCACTGAGTGAGATTAACCTACAGTACAACTTCATACACGGTCCCATTCCAGAGTCCTTTGGAGATTTACCTTCCCTAAGTGTTCTTAGTCTTACACACAACAGTCTAGAAGGGAGCTTCCCAAGTAGAATCTTCCAGAACAAAAACTTAACCTCTGTTGATGTTAGGTACAACTTCGAACTCTCCGGTTCGTTGCCAAAAAATATCTCATCAAATGACATTTTGGTAGATCTTCTTGTTAGCAGTACTAACTTCTCTGGTCCAATCCCTAACTCAGTAGGCAACATCAAATCCTTGGAAAATTTGGGTGTTGCATCAAGTGACTTCTCCCAAGAGCTTCCCTCTTCTATTGGCCAGCTGAGATCGTTGAATTCGTTAGAGATTACAGGGGCTGGTGTAGTAGGAGCAGTACCATCTTGGATTGCAAATTTGACTTCATTGACCCTTCTCGACTTCTCGAACTGTGGCTTATCTGGGAAGATACCATCTGCGATAGGTGCTATCAAGAATCTGAAGAGGTTAGCGTTATACAAATGTAACTTTTCTGGCCAAATACCTCAAGATCTATTTAACCTAACTCAATTGAGAGTCATATATCTTCAATATAATAACTTCATTGGTACGTTGGAGCTCAGCTCATTTTGGAAACTACCAGACCTATTTTCTTTGAATCTTTCCAACAACAAACTATCAGTTGTAGATGGTGAGAAAAATAATTCTTCATGGGTGTCCATAAACTATTTCTACACCTTGCGCCTAGCATATTGTAACATATCCAATTTCCCTAGTGCCTTGAGTCTCATGCCTTGGGTTGGAAATCTTGATCTTTCAGGAAATCAGATCCATGGTACTATACCTCAGTGGGCGTGGGAAACTTCGAGCGAGTTGTTTATCCTCAACTTATTACACAACAAATTCGACAATATAGGATATAATTATCTTCCATTTTACTTAGAGATTGTTGATCTCAGTTATAACTTATTCCAAGGACCCATACCTATAACTGGACCTGACACTTGGTTGCTCGATTGCTCAAACAACCGGTTCTCATCCATGCCATTTAACTTCAGTTCCCAGCTTAGTGGGATGTCCTATCTCATGGCCTCCAGAAACAACCTATCTGGAGAAATTCCACTCTCAATTTGTGATGCAAGGGACATTCTGCTCCTTGATCTTTCTTACAACAATTTAAGTGGCTTGATTCCACTTTGTTTACTGGAGGATATCAATTCCCTTAGTGTGTTCAACTTGAAAGCAAATCAACTTCATGGTGAGTTACCTCGTAATATCAAGAAAGGATGTGCATTAGAGGCATTAGATTTCAGTGAGAACATGTTTGAAGGACAACTACCCACATCTCTAGTTGCTTGCAGAGATTTGGAGGTTTTAGACATTGGAAATAATCAGATTAGCGGTGGTTTTCCATGTTGGGCTAGTATGCTTCCTAAACTTCAGGTTCTTGTCCTGAAGTCCAACAAGTTCACCGGAGAGGTGGGGTCTTCTGCCATCGAAAAAGATAACACTTGCGAATTTGCAAATCTACGGATTCTTGATTTGGCTTCAAACAACTTTTCTGGTACTCTACATCACAAGTGGTTGAAAAGGTTAAAATCCATGATGGAGACATCTTCTAGTGCGACATTGCTTATGCAATATCAGCACAACGTGCATAGTACAACATATCAGTTTTCTACTTCAATCGCATATAAAGGGTATGAAGTCACATTTACAAAAATCTTGAGGACCCTTGTAGTCATCGATGTTTCAGACAATGCACTCCATGGTAGCATTCCCAAGTCAATTGGAGAGCTCGTTCTCCTCCGTGGGCTAAACATGTCACATAATGCCCTCACAGGACCAATTCCATCTCAGCTTGGTGCTCTGCATGAACTCGAGTCATTGGACCTCTCATCAAATGATCTTTCAGGGGAGATTCCACAGGAGTTAGCACAGCTACACTTCCTCTCAGTGCTGAACCTGTCCTACAACGGTTTGGTTGGGAGAATACCAGATTCACCCCAGTTCTCGAACAATCTCTCCTATCTGGGGAACATTGGTCTATGTGGGTTTCCATTGTCCAAGGAATGCAGCAACATGACAACACCACCAAGCTCACATCCTTCAGAGGAAAAACATGTGGATGTTATACTGTTCCTCTTTGTTGGACTTGGAGTTGGCATCGGGTTTGCAGTTATAATCGTTGTGACATGGGGAATCCGCATCAAGAAAAGGTCCCAAGACAGCAGATTTCCGTTTTGGAAAAAAGTTCTCTGTATGTAA


Protein sequences

Name Description Sequence
unnamed protein product [Oryza sativa Japonica Group]. unnamed protein product [Oryza sativa Japonica Group].

MSSPIAIGRRHGPPPLLLHLLILHLLLGFQHLCYSLATYSNRSTAAMPAPCLPDQAAALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLGNIGLCGFPLSKECSNMTTPPSSHPSEEKHVDVILFLFVGLGVGIGFAVIIVVTWGIRIKKRSQDSRFPFWKKVLCM


Domains

Domain Start-End Description Sequence

HMMPfam: PF08263
IPR013210
53-93 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQAAALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRC

HMMPanther: PTHR26393
58-1015 PTHR26393,FAMILY NOT NAMED

ALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLGNIGLCGFPLSKECSNMTTPPSSHPSEEKHVDVILFLFVGLGVGIGFAVIIVVTWGIRI

HMMPanther: PTHR26393:SF519
58-1015 PTHR26393:SF519

ALLRLKHSFNMTNKSECTLASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLGNIGLCGFPLSKECSNMTTPPSSHPSEEKHVDVILFLFVGLGVGIGFAVIIVVTWGIRI

superfamily: SSF52058
76-333 SSF52058,LRR

LASWRAGTDCCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLSTDFFLIDLDDEFLSVATYSPAWLLVAPNIVSIVANLHNLKELYMGTIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNF

Gene3D: G3DSA:3.80.10.10
85-183 G3DSA:3.80.10.10

CCRWEGVRCGVGIGVGHVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSKFAGQIPNTIGRLTNLISLDLS

HMMPfam: PF13855
101-162 LRR_8,Leucine rich repeat

HVTSLDLGECGLESAALDPALFELTSLRHLNLAWNNFSGSHIPTIGFERLTELTYLNLSNSK

Gene3D: G3DSA:3.80.10.10
229-427 G3DSA:3.80.10.10

TIDLSSNSMVQWCSAFSNSTTPQLQVLSLPYCYLEVPICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFS

superfamily: SSF52047
265-591 SSF52047,LRR

PICESLSGIRSLSEINLQYNFIHGPIPESFGDLPSLSVLSLTHNSLEGSFPSRIFQNKNLTSVDVRYNFELSGSLPKNISSNDILVDLLVSSTNFSGPIPNSVGNIKSLENLGVASSDFSQELPSSIGQLRSLNSLEITGAGVVGAVPSWIANLTSLTLLDFSNCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFY

HMMPfam: PF13516
418-440 LRR_6,Leucine Rich repeat

LTSLTLLDFSNCGLSGKIPSAIG

Gene3D: G3DSA:3.80.10.10
428-600 G3DSA:3.80.10.10

NCGLSGKIPSAIGAIKNLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKLSVVDGEKNNSSWVSINYFYTLRLAYCNISNFPSALSLMPWVGNLDLSGNQIHGTIPQWAWETSSELFILNLLHNKFDNIGYNYLPFYLEIVDLSYN

HMMPfam: PF13855
444-504 LRR_8,Leucine rich repeat

NLKRLALYKCNFSGQIPQDLFNLTQLRVIYLQYNNFIGTLELSSFWKLPDLFSLNLSNNKL

superfamily: SSF52047
592-957 SSF52047,LRR

LEIVDLSYNLFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETSSSATLLMQYQHNVHSTTYQFSTSIAYKGYEVTFTKILRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYLG

Gene3D: G3DSA:3.80.10.10
601-817 G3DSA:3.80.10.10

LFQGPIPITGPDTWLLDCSNNRFSSMPFNFSSQLSGMSYLMASRNNLSGEIPLSICDARDILLLDLSYNNLSGLIPLCLLEDINSLSVFNLKANQLHGELPRNIKKGCALEALDFSENMFEGQLPTSLVACRDLEVLDIGNNQISGGFPCWASMLPKLQVLVLKSNKFTGEVGSSAIEKDNTCEFANLRILDLASNNFSGTLHHKWLKRLKSMMETS

FPrintScan: PR00019
661-674 LEURICHRPT,Leucine-rich repeat signature

ILLLDLSYNNLSGL

HMMPfam: PF13516
731-746 LRR_6,Leucine Rich repeat

CRDLEVLDIGNNQISG

HMMPfam: PF00560
IPR001611
787-809 LRR_1
Leucine-rich repeat

NLRILDLASNNFSGTLHHKWLKR

Gene3D: G3DSA:3.80.10.10
854-956 G3DSA:3.80.10.10

LRTLVVIDVSDNALHGSIPKSIGELVLLRGLNMSHNALTGPIPSQLGALHELESLDLSSNDLSGEIPQELAQLHFLSVLNLSYNGLVGRIPDSPQFSNNLSYL

FPrintScan: PR00019
902-915 LEURICHRPT,Leucine-rich repeat signature

LHELESLDLSSNDL

HMMPfam: PF13516
905-925 LRR_6,Leucine Rich repeat

LESLDLSSNDLSGEIPQELAQ


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox