PRGDB00049714 (unnamed protein product [Oryza sativa Japonica Group].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Oryza sativa Japonica Group].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32984982 (AK099773)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cDNA clone:J013095E04, full insert sequence.

DNA Sequence

ATGTCGACACGAGCACGGTCGCCGTGGTGGAGCCGCCGGCGAACGGCGCCGACACTTTCCACCACTCTGTCGTCGTTGCTTCTCCTACTGGCGACGACGACGACCAAATTGTGCCGGAGCTGCAGCGACGGCGAGCGTCACGCCCTCCTACGCCGCATCCAGCCGCTCATCGGCCCTGAGTTCTCCTCCAGCGGACGGTTGGATTGGGACGAGGCCGTGGACTGCTGCCGCTGGGAGGGCGTCACATGCAGCGTCGCCGGCCGACGACGAGAAGCAGCAGCTGGTGGCCGCCGTGTCGTGTCGCTGTCGCTCCCTGGAGTCGGCATCGCCGGCGCCGTGGATGCCGCCGTGCTTGCGCCGTTCACGGCGCTTGAGAAGCTCGACCTGTCCGGCAATCAAATCACTAGCTTTTCAGCTGCTAATCGCTCAGACATGGTTGTCGGTGCTGTTCTCAACAACTTAACCGCACTTACGGAGCTGCACCTAGCCGGGAATGAGATCACCACCACAGGCTGGATTTCCAATTTGACGTCCCTGCAGGTTATTGACATGTCCAGCAATAAAGTACATGAGCTCAACGGTATTTGTGGCCTCCATCAACTAAAATATCTAAGCCTTGGTTTTAACATGATACAAGGAGTAATTAATCCATGCTTGGGGAAATTGCAGTACCTGGTATACTTGGACATGGGATCAAATTTTCTCACAGGTGAGATTGGACAATATTTACTAAGCAACTTAACCCAAGTAGAAGAAGTACATCTTGGGGACAACAATCTTACTGGCACATTTGACTTCTCGTCTTTGGCTAACAACTCTGAGCTCCACAGCATCGTCCTCTCGAACAACTGCAAACTAGAAATCGAAACGGAGCTTGTAAGGTGGACACCGTTGTTCCAGCTCGAATACTTGAATCTAAGCAATAGTATTGTCAACAAGAGAAGCAACGGGATCATCCCAACTTTTCTGTCAGCCCAAGTGAGCCTCTCTGGGATTGATCTCTCCATATGTTCACTCCAGGGGAGGATCCCATCTTGGATGTTGTTGTATAACGTTTCTTTAGGTTTCCTCTTGCTGCGCGGTAATAGCATGGATTTCCTCGACACTGGCAATCTCGGAGCCAACGTTACGTCATCAATGGAGGTGCTTGATCTGTCTGACAACAGGATATCAATGAAAATGCCATACAACTTTGGAAGTCTATTTCCATATCTAAAGTACCTTGACATGTCTTCCAACATGCTGAATGGCGGAGTTCCATCACTAGCAGAAGCCGCGTCATCGTTGCAGTTTCTTGACTTGTCATTTAACATGCTCAATGGGGAGATATCGCCGGAATTAATAGGGAATGCATCCATTTTGACATCCCTTCTGCTCTCACACAATGACCTAACTGGGCCTATGCCACCCTTCCATTGGAGCCTAGGGCAGTTGACTCACCTGAGCGTTGAAAACAACCAACTATCTGGTCGTTTGCCGCCTCTACTTACGAACTGCACCAACCTTGAGAATCTCAATGTGAGGAATAACCGTTTATCTGGTGTAATCCCAGTAGGCCTCCTCAGCTTTGAGAAGCTTGGTGCTCTCCTCCTTGGAGGAAACCAGTTTCATGGTGTCATTCCTTGGGATATTTGCCTCAACAACCATATCCACTTCATAGATCTTTCCAATAATTGGTTCTCTGGTGAGATACAGGTTGCTTATACAGTGTTTTCTGGTCAGAGCTGCCAATGA


Protein sequences

Name Description Sequence
unnamed protein product [Oryza sativa Japonica Group]. unnamed protein product [Oryza sativa Japonica Group].

MSTRARSPWWSRRRTAPTLSTTLSSLLLLLATTTTKLCRSCSDGERHALLRRIQPLIGPEFSSSGRLDWDEAVDCCRWEGVTCSVAGRRREAAAGGRRVVSLSLPGVGIAGAVDAAVLAPFTALEKLDLSGNQITSFSAANRSDMVVGAVLNNLTALTELHLAGNEITTTGWISNLTSLQVIDMSSNKVHELNGICGLHQLKYLSLGFNMIQGVINPCLGKLQYLVYLDMGSNFLTGEIGQYLLSNLTQVEEVHLGDNNLTGTFDFSSLANNSELHSIVLSNNCKLEIETELVRWTPLFQLEYLNLSNSIVNKRSNGIIPTFLSAQVSLSGIDLSICSLQGRIPSWMLLYNVSLGFLLLRGNSMDFLDTGNLGANVTSSMEVLDLSDNRISMKMPYNFGSLFPYLKYLDMSSNMLNGGVPSLAEAASSLQFLDLSFNMLNGEISPELIGNASILTSLLLSHNDLTGPMPPFHWSLGQLTHLSVENNQLSGRLPPLLTNCTNLENLNVRNNRLSGVIPVGLLSFEKLGALLLGGNQFHGVIPWDICLNNHIHFIDLSNNWFSGEIQVAYTVFSGQSCQ


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF499
17-467 PTHR24420:SF499,OS04G0119800 PROTEIN (FRAGMENT)

PTLSTTLSSLLLLLATTTTKLCRSCSDGERHALLRRIQPLIGPEFSSSGRLDWDEAVDCCRWEGVTCSVAGRRREAAAGGRRVVSLSLPGVGIAGAVDAAVLAPFTALEKLDLSGNQITSFSAANRSDMVVGAVLNNLTALTELHLAGNEITTTGWISNLTSLQVIDMSSNKVHELNGICGLHQLKYLSLGFNMIQGVINPCLGKLQYLVYLDMGSNFLTGEIGQYLLSNLTQVEEVHLGDNNLTGTFDFSSLANNSELHSIVLSNNCKLEIETELVRWTPLFQLEYLNLSNSIVNKRSNGIIPTFLSAQVSLSGIDLSICSLQGRIPSWMLLYNVSLGFLLLRGNSMDFLDTGNLGANVTSSMEVLDLSDNRISMKMPYNFGSLFPYLKYLDMSSNMLNGGVPSLAEAASSLQFLDLSFNMLNGEISPELIGNASILTSLLLSHNDLTGP

HMMPanther: PTHR24420
17-467 PTHR24420,FAMILY NOT NAMED

PTLSTTLSSLLLLLATTTTKLCRSCSDGERHALLRRIQPLIGPEFSSSGRLDWDEAVDCCRWEGVTCSVAGRRREAAAGGRRVVSLSLPGVGIAGAVDAAVLAPFTALEKLDLSGNQITSFSAANRSDMVVGAVLNNLTALTELHLAGNEITTTGWISNLTSLQVIDMSSNKVHELNGICGLHQLKYLSLGFNMIQGVINPCLGKLQYLVYLDMGSNFLTGEIGQYLLSNLTQVEEVHLGDNNLTGTFDFSSLANNSELHSIVLSNNCKLEIETELVRWTPLFQLEYLNLSNSIVNKRSNGIIPTFLSAQVSLSGIDLSICSLQGRIPSWMLLYNVSLGFLLLRGNSMDFLDTGNLGANVTSSMEVLDLSDNRISMKMPYNFGSLFPYLKYLDMSSNMLNGGVPSLAEAASSLQFLDLSFNMLNGEISPELIGNASILTSLLLSHNDLTGP

superfamily: SSF52058
45-368 SSF52058,LRR

ERHALLRRIQPLIGPEFSSSGRLDWDEAVDCCRWEGVTCSVAGRRREAAAGGRRVVSLSLPGVGIAGAVDAAVLAPFTALEKLDLSGNQITSFSAANRSDMVVGAVLNNLTALTELHLAGNEITTTGWISNLTSLQVIDMSSNKVHELNGICGLHQLKYLSLGFNMIQGVINPCLGKLQYLVYLDMGSNFLTGEIGQYLLSNLTQVEEVHLGDNNLTGTFDFSSLANNSELHSIVLSNNCKLEIETELVRWTPLFQLEYLNLSNSIVNKRSNGIIPTFLSAQVSLSGIDLSICSLQGRIPSWMLLYNVSLGFLLLRGNSMDFLD

HMMPfam: PF08263
IPR013210
48-84 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ALLRRIQPLIGPEFSSSGRLDWDEAVDCCRWEGVTCS

Gene3D: G3DSA:3.80.10.10
71-85 G3DSA:3.80.10.10

EAVDCCRWEGVTCSV

Gene3D: G3DSA:3.80.10.10
117-161 G3DSA:3.80.10.10

VLAPFTALEKLDLSGNQITSFSAANRSDMVVGAVLNNLTALTELH

ProfileScan: PS51450
IPR001611
123-144 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALEKLDLSGNQITSFSAANRSD

HMMPfam: PF00560
IPR001611
124-138 LRR_1
Leucine-rich repeat

LEKLDLSGNQITSFS

ProfileScan: PS51450
IPR001611
156-177 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALTELHLAGNEITTTGWISNLT

HMMPfam: PF13855
156-211 LRR_8,Leucine rich repeat

ALTELHLAGNEITTTGWISNLTSLQVIDMSSNKVHELNGICGLHQLKYLSLGFNMI

Gene3D: G3DSA:3.80.10.10
162-388 G3DSA:3.80.10.10

LAGNEITTTGWISNLTSLQVIDMSSNKVHELNGICGLHQLKYLSLGFNMIQGVINPCLGKLQYLVYLDMGSNFLTGEIGQYLLSNLTQVEEVHLGDNNLTGTFDFSSLANNSELHSIVLSNNCKLEIETELVRWTPLFQLEYLNLSNSIVNKRSNGIIPTFLSAQVSLSGIDLSICSLQGRIPSWMLLYNVSLGFLLLRGNSMDFLDTGNLGANVTSSMEVLDLSDN

ProfileScan: PS51450
IPR001611
178-199 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQVIDMSSNKVHELNGICGLH

ProfileScan: PS51450
IPR001611
200-223 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKYLSLGFNMIQGVINPCLGKLQ

superfamily: SSF52058
309-565 SSF52058,LRR

SIVNKRSNGIIPTFLSAQVSLSGIDLSICSLQGRIPSWMLLYNVSLGFLLLRGNSMDFLDTGNLGANVTSSMEVLDLSDNRISMKMPYNFGSLFPYLKYLDMSSNMLNGGVPSLAEAASSLQFLDLSFNMLNGEISPELIGNASILTSLLLSHNDLTGPMPPFHWSLGQLTHLSVENNQLSGRLPPLLTNCTNLENLNVRNNRLSGVIPVGLLSFEKLGALLLGGNQFHGVIPWDICLNNHIHFIDLSNNWFSGEIQ

ProfileScan: PS51450
IPR001611
379-400 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SMEVLDLSDNRISMKMPYNFGS

HMMPfam: PF00560
IPR001611
380-401 LRR_1
Leucine-rich repeat

MEVLDLSDNRISMKMPYNFGSL

Gene3D: G3DSA:3.80.10.10
389-565 G3DSA:3.80.10.10

RISMKMPYNFGSLFPYLKYLDMSSNMLNGGVPSLAEAASSLQFLDLSFNMLNGEISPELIGNASILTSLLLSHNDLTGPMPPFHWSLGQLTHLSVENNQLSGRLPPLLTNCTNLENLNVRNNRLSGVIPVGLLSFEKLGALLLGGNQFHGVIPWDICLNNHIHFIDLSNNWFSGEIQ

ProfileScan: PS51450
IPR001611
404-426 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLKYLDMSSNMLNGGVPSLAEAA

ProfileScan: PS51450
IPR001611
428-450 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQFLDLSFNMLNGEISPELIGN

HMMPfam: PF00560
IPR001611
428-449 LRR_1
Leucine-rich repeat

SLQFLDLSFNMLNGEISPELIG

ProfileScan: PS51450
IPR001611
453-474 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ILTSLLLSHNDLTGPMPPFHWS

ProfileScan: PS51450
IPR001611
477-499 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLTHLSVENNQLSGRLPPLLTNC

HMMPfam: PF12799
477-514 LRR_4,Leucine Rich repeats (2 copies)

QLTHLSVENNQLSGRLPPLLTNCTNLENLNVRNNRLSG

ProfileScan: PS51450
IPR001611
501-522 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLENLNVRNNRLSGVIPVGLLS


List of References

, National Institute of Agrobiological Sciences Rice Full-Length cDNA Project Team, Shoshi Kikuchi, Kouji Satoh, Toshifumi Nagata, Nobuyuki Kawagashira, Koji Doi, Naoki Kishimoto, Junshi Yazaki, Masahiro Ishikawa, Hitomi Yamada, Hisako Ooka, Isamu Hotta, Keiichi Kojima, Takahiro Namiki, Eisuke Ohneda, Wataru Yahagi, Kohji Suzuki, Chao Jie Li, Kenji Ohtsuki, Toru Shishiki, Foundation of Advancement of International Science Genome Sequencing & Analysis Group, Yasuhiro Otomo, Kazuo Murakami, Yoshiharu Iida, Sumio Sugano, Tatsuto Fujimura, Yutaka Suzuki, Yuki Tsunoda, Takashi Kurosaki, Takeko Kodama, Hiromi Masuda, Michie Kobayashi, Quihong Xie, Min Lu, Ryuya Narikawa, Akio Sugiyama, Kouichi Mizuno, Satoko Yokomizo, Junko Niikura, Rieko Ikeda, Junya Ishibiki, Midori Kawamata, Akemi Yoshimura, Junichirou Miura, Takahiro Kusumegi, Mitsuru Oka, Risa Ryu, Mariko Ueda, Kenichi Matsubara, RIKEN, Jun Kawai, Piero Carninci, Jun Adachi, Katsunori Aizawa, Takahiro Arakawa, Shiro Fukuda, Ayako Hara, Wataru Hashizume, Norihito Hayatsu, Koichi Imotani, Yoshiyuki Ishii, Masayoshi Itoh, Ikuko Kagawa, Shinji Kondo, Hideaki Konno, Ai Miyazaki, Naoki Osato, Yoshimi Ota, Rintaro Saito, Daisuke Sasaki, Kenjiro Sato, Kazuhiro Shibata, Akira Shinagawa, Toshiyuki Shiraki, Masayasu Yoshino, Yoshihide Hayashizaki, Ayako Yasunishi
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science: 2003, 301(5631);376-9
PubMed:12869764 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox