PRGDB00049734 (unnamed protein product [Oryza sativa Japonica Group].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Oryza sativa Japonica Group].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32980197 (AK070173)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cDNA clone:J023041K23, full insert sequence.

DNA Sequence

ATGACCACCCATCACGACCCAGCAGCAGCAGCATCTGCACCGATAGTGCGGATGCTGCTCCTTGTCCTGCTACAAATCCAGCTCGTCGCCGCGCTCTCGCTTCTCCCGCCGGCATCAGCACCACCGCCGGCCGCTCTCCCATGCCGTCCGGACCAGGAGTCACCGCTGCTCCGGCTGAAGAGCTCCTTCTCCGCCACCGACATGTCCACGGCGGCTTTCCGGTCATGGCGACCCGGCACGGACTGCTGCCGCTGGGACGGCGTCCGCTGTGGCCACGGCGACGGCCGCGTGACCTCCCTCGACCTGGGCGGCCGTCAGCTGGAGAGCAGAGGAGGCCTCGACCCAGCAATCTTCCATCTCACATCCCTCGAGTATCTTAGCCTCGCCGACAATGACTTCAACGGGTCTCCTCTCCCTTCCAGCGGCTTTGAGCGTCTCACAGAGCTCACCCATCTCAGCCTTCGCAGCACCAACATTACAGGCGTGGTACCAGCCGGAATCGGCCGTTTGGTGAATTTGGTATCCCTTGATCTCTCCACAGACTTTGAGATAATCGACACATTTGATGATGTCTATGTTTTTAAAATGAATTCGAGTCTCGATGCCCAACAGCTCGCTGTGCCAAACCTGGAAAGCTTAGTCGCAAACCTTAGCAATTTAAGGGAGCTCAACCTTGGCTTAGTAAACTTATCTGAAAATGGCGCCAGATGGTGCAACGCTCTAGTCGATTCCTGCCCAAAACTTCAGGTTCTTCGTTTGTCTTGCTGTGCTCTCTCTGGCCCAATATGTGCAACACTTCCCCGTTTGCACTCACTTTCTGTTATTGACCTATCGTTTAATAGTTTGCCCGGGCTAATTCCAGATTTCTCCAACTTTCCTAATTTGACTGCCCTCCAACTTAGACGTAATGACCTTGAAGGATTTGTCTCTCCATTGATCTTTAAGCACAAGAAACTAGTAACTATTGATCTTTACCATAATCCAGGAATATATGGTACTTTGCCAAACTTTTCATCTGATAGTCATTTGGAAAATATATATGTTGGTGGAACTGAATTCAATGGTATAATACCAAGTTCCATCGCTGAACTCAAATCTTTGAAGAATCTAGGCCTAGGAGCAACTGGCTTTTCTGGAGAACTGCCCTCATCAATTGGAAACCTCAGATCCTTGAAGTCATTAGAGATTTCCGGTTTTGGACTAGTAGGGTCCATACCATCATGGGTTGCGAACCTATCCTCTTTGACTGTGCTTCAGTTCACAAATTGTGGCTTATCTGGATCAATACCATCCTCTGTCGGTAACCTTAGGAATTTGGGAAAACTACTATTGTATAATTGCAGCTTTTCAGGAAAGATACCTTCACAAATCTTGAACTTAACACAGCTAGAAATACTCTCGCTTCATTCAAACAACTTCATTGGCACAGTAGAGCTTACCTCGATGTGGAAACTACTAGACCTGTTTGTCTTGGATCTTTCAGATAATAATCTGGTCGTTGTAGATGGAAAGGGTAATTCTTCAACGGCATCCATCCCCAAACTAGGAGCGTTACGTTTATCAGGTTGCAATGTTTCGAAATTCCCTAATTTCTTGAGGTTCCAAGATGAAATCGAATATCTTGATCTTTCATATAACCATATCGATGGAGCCATACCCCAATGGGCATGGGAGAATTGGGTCAAAATGGACATACTATCCTTGAAGAACAATAAGTTTACAAGTGTTGGGCATGACCCTTTTCTTCCTTTAAGTGATATGAAAGCACTTGATCTTAGTGAGAACATGTTTGAGGGGCCCATACCTATACCTCGAGGATATGCAACTGTGCTTGACTACTCAGGAAACAGGTTCTCATCTATACCATTTAAGTTTACCAATTATCTCAGTGATGTCTCGTTTTTCAAGGCCGGTAGAAACAATTTCTCTGGAAGAATTCCTCCATCCTTTTGTAGTGCAATGAGTTTACAGCTCCTTGATCTCTCATACAATAGCTTTGATGGTTCAATTCCTTCTTGTTTAATAGAGGATGTTGACAAACTGGAAGTATTAAATCTAAAAGAAAATAAGCTTCGTGGGGAATTTCCGGACAATATCAAGGAAAGTTGCTCATTTGAGGCACTGGATTTCAGTGGCAATTTGATTGAAGGGAAACTGCCAAGATCTCTGGCCGTTTGCAAAAACTTGGAGGTCCTTAATATTGGAAGCAATCAGATTAATGATTCCTTTCCATGTTGGATGGGCACACTTCGTAAACTTCAAGTTCTTGTGCTGAAATCAAACAAGTTTTTTGGGCATGTAGCACAGTCTCTGGGGGAAGAAAAAGGTACATGTGAATTTCAGAGCGCAAGAATTGTTGATCTAGCATCCAACAAGTTCTCTGGCATCTTGCCGCAAGAGTGGTTTAACAAGTTAAAGTCAATGATGATCAAAGATTCAAATTTGACATTGGTCATGGACCATGATCTCCCACGAATGGAGAAATATGATTTTACTGTTGCACTCACATACAAAGGGATGGACATCACATTTACTAAGATCTTGAGGACCCTTGTATTCATTGATTTATCAGATAACGCATTCCATGGCAGCCTACCTGAAGCTATAGGTGAACTTGTTCTGCTAAACGTGCTCAACATATCACACAACTCACTGACGGGGCCGATTCCACCTCAGCTTGGTCGTTTAACCCAGCTTGAGTCGTTGGACATCTCATCAAATGAGCTTTCAGGAGAAATCCCACAGCAGTTGGCATCCTTGGACTTCCTCACAGTGTTGAACCTGTCCTACAACAAGCTGGAGGGGGAAATACCAGAATCGCCTCATTTCTTGACATTCTCCAATAGTTCATTTCTGGGGAACGATGGTTTGTGCGGTCGTCCACTGTCGAAAGGATGCATCAACATTACATCTCTGAATGTGATCCCTTCCAAGAAGAATTCACTTGACGTTTTGCTATTCCTTTTTGCTGGATTGGGATTCGGCTTTGGATTTGCCCTTTCAATTGTGGTTATATGGGGAATTCCCATCAGAAAGCGGTCTCGAGTAAGGCAGAGAGCCCTCTGA


Protein sequences

Name Description Sequence
unnamed protein product [Oryza sativa Japonica Group]. unnamed protein product [Oryza sativa Japonica Group].

MTTHHDPAAAASAPIVRMLLLVLLQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393
24-1021 PTHR26393,FAMILY NOT NAMED

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

HMMPanther: PTHR26393:SF522
24-1021 PTHR26393:SF522

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

Gene3D: G3DSA:3.80.10.10
48-324 G3DSA:3.80.10.10

CRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDL

HMMPfam: PF08263
IPR013210
51-90 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRC

superfamily: SSF52047
99-450 SSF52047,LRR

SLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFS

HMMPfam: PF13855
246-305 LRR_8,Leucine rich repeat

PKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDL

Gene3D: G3DSA:3.80.10.10
325-519 G3DSA:3.80.10.10

YHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALR

superfamily: SSF52047
452-842 SSF52047,LRR

KIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDI

Gene3D: G3DSA:3.80.10.10
520-674 G3DSA:3.80.10.10

LSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCL

Gene3D: G3DSA:3.80.10.10
677-810 G3DSA:3.80.10.10

DVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMI

HMMPfam: PF13855
707-762 LRR_8,Leucine rich repeat

ALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNK

superfamily: SSF52058
780-962 SSF52058,LRR

FQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPL

Gene3D: G3DSA:3.80.10.10
854-963 G3DSA:3.80.10.10

IDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLS

HMMPfam: PF12799
875-910 LRR_4,Leucine Rich repeats (2 copies)

LNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELS

HMMPfam: PF00560
IPR001611
923-940 LRR_1
Leucine-rich repeat

LTVLNLSYNKLEGEIPES


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox