PRGDB00049734 (unnamed protein product [Oryza sativa Japonica Group].)

From PRG Wiki
Jump to: navigation, search
unnamed protein product [Oryza sativa Japonica Group].
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 32980197 (AK070173)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa Japonica Group cDNA clone:J023041K23, full insert sequence.

DNA Sequence

ATGACCACCCATCACGACCCAGCAGCAGCAGCATCTGCACCGATAGTGCGGATGCTGCTCCTTGTCCTGCTACAAATCCAGCTCGTCGCCGCGCTCTCGCTTCTCCCGCCGGCATCAGCACCACCGCCGGCCGCTCTCCCATGCCGTCCGGACCAGGAGTCACCGCTGCTCCGGCTGAAGAGCTCCTTCTCCGCCACCGACATGTCCACGGCGGCTTTCCGGTCATGGCGACCCGGCACGGACTGCTGCCGCTGGGACGGCGTCCGCTGTGGCCACGGCGACGGCCGCGTGACCTCCCTCGACCTGGGCGGCCGTCAGCTGGAGAGCAGAGGAGGCCTCGACCCAGCAATCTTCCATCTCACATCCCTCGAGTATCTTAGCCTCGCCGACAATGACTTCAACGGGTCTCCTCTCCCTTCCAGCGGCTTTGAGCGTCTCACAGAGCTCACCCATCTCAGCCTTCGCAGCACCAACATTACAGGCGTGGTACCAGCCGGAATCGGCCGTTTGGTGAATTTGGTATCCCTTGATCTCTCCACAGACTTTGAGATAATCGACACATTTGATGATGTCTATGTTTTTAAAATGAATTCGAGTCTCGATGCCCAACAGCTCGCTGTGCCAAACCTGGAAAGCTTAGTCGCAAACCTTAGCAATTTAAGGGAGCTCAACCTTGGCTTAGTAAACTTATCTGAAAATGGCGCCAGATGGTGCAACGCTCTAGTCGATTCCTGCCCAAAACTTCAGGTTCTTCGTTTGTCTTGCTGTGCTCTCTCTGGCCCAATATGTGCAACACTTCCCCGTTTGCACTCACTTTCTGTTATTGACCTATCGTTTAATAGTTTGCCCGGGCTAATTCCAGATTTCTCCAACTTTCCTAATTTGACTGCCCTCCAACTTAGACGTAATGACCTTGAAGGATTTGTCTCTCCATTGATCTTTAAGCACAAGAAACTAGTAACTATTGATCTTTACCATAATCCAGGAATATATGGTACTTTGCCAAACTTTTCATCTGATAGTCATTTGGAAAATATATATGTTGGTGGAACTGAATTCAATGGTATAATACCAAGTTCCATCGCTGAACTCAAATCTTTGAAGAATCTAGGCCTAGGAGCAACTGGCTTTTCTGGAGAACTGCCCTCATCAATTGGAAACCTCAGATCCTTGAAGTCATTAGAGATTTCCGGTTTTGGACTAGTAGGGTCCATACCATCATGGGTTGCGAACCTATCCTCTTTGACTGTGCTTCAGTTCACAAATTGTGGCTTATCTGGATCAATACCATCCTCTGTCGGTAACCTTAGGAATTTGGGAAAACTACTATTGTATAATTGCAGCTTTTCAGGAAAGATACCTTCACAAATCTTGAACTTAACACAGCTAGAAATACTCTCGCTTCATTCAAACAACTTCATTGGCACAGTAGAGCTTACCTCGATGTGGAAACTACTAGACCTGTTTGTCTTGGATCTTTCAGATAATAATCTGGTCGTTGTAGATGGAAAGGGTAATTCTTCAACGGCATCCATCCCCAAACTAGGAGCGTTACGTTTATCAGGTTGCAATGTTTCGAAATTCCCTAATTTCTTGAGGTTCCAAGATGAAATCGAATATCTTGATCTTTCATATAACCATATCGATGGAGCCATACCCCAATGGGCATGGGAGAATTGGGTCAAAATGGACATACTATCCTTGAAGAACAATAAGTTTACAAGTGTTGGGCATGACCCTTTTCTTCCTTTAAGTGATATGAAAGCACTTGATCTTAGTGAGAACATGTTTGAGGGGCCCATACCTATACCTCGAGGATATGCAACTGTGCTTGACTACTCAGGAAACAGGTTCTCATCTATACCATTTAAGTTTACCAATTATCTCAGTGATGTCTCGTTTTTCAAGGCCGGTAGAAACAATTTCTCTGGAAGAATTCCTCCATCCTTTTGTAGTGCAATGAGTTTACAGCTCCTTGATCTCTCATACAATAGCTTTGATGGTTCAATTCCTTCTTGTTTAATAGAGGATGTTGACAAACTGGAAGTATTAAATCTAAAAGAAAATAAGCTTCGTGGGGAATTTCCGGACAATATCAAGGAAAGTTGCTCATTTGAGGCACTGGATTTCAGTGGCAATTTGATTGAAGGGAAACTGCCAAGATCTCTGGCCGTTTGCAAAAACTTGGAGGTCCTTAATATTGGAAGCAATCAGATTAATGATTCCTTTCCATGTTGGATGGGCACACTTCGTAAACTTCAAGTTCTTGTGCTGAAATCAAACAAGTTTTTTGGGCATGTAGCACAGTCTCTGGGGGAAGAAAAAGGTACATGTGAATTTCAGAGCGCAAGAATTGTTGATCTAGCATCCAACAAGTTCTCTGGCATCTTGCCGCAAGAGTGGTTTAACAAGTTAAAGTCAATGATGATCAAAGATTCAAATTTGACATTGGTCATGGACCATGATCTCCCACGAATGGAGAAATATGATTTTACTGTTGCACTCACATACAAAGGGATGGACATCACATTTACTAAGATCTTGAGGACCCTTGTATTCATTGATTTATCAGATAACGCATTCCATGGCAGCCTACCTGAAGCTATAGGTGAACTTGTTCTGCTAAACGTGCTCAACATATCACACAACTCACTGACGGGGCCGATTCCACCTCAGCTTGGTCGTTTAACCCAGCTTGAGTCGTTGGACATCTCATCAAATGAGCTTTCAGGAGAAATCCCACAGCAGTTGGCATCCTTGGACTTCCTCACAGTGTTGAACCTGTCCTACAACAAGCTGGAGGGGGAAATACCAGAATCGCCTCATTTCTTGACATTCTCCAATAGTTCATTTCTGGGGAACGATGGTTTGTGCGGTCGTCCACTGTCGAAAGGATGCATCAACATTACATCTCTGAATGTGATCCCTTCCAAGAAGAATTCACTTGACGTTTTGCTATTCCTTTTTGCTGGATTGGGATTCGGCTTTGGATTTGCCCTTTCAATTGTGGTTATATGGGGAATTCCCATCAGAAAGCGGTCTCGAGTAAGGCAGAGAGCCCTCTGA


Protein sequences

Name Description Sequence
unnamed protein product [Oryza sativa Japonica Group]. unnamed protein product [Oryza sativa Japonica Group].

MTTHHDPAAAASAPIVRMLLLVLLQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393
24-1021 PTHR26393,FAMILY NOT NAMED

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

HMMPanther: PTHR26393:SF522
24-1021 PTHR26393:SF522

LQIQLVAALSLLPPASAPPPAALPCRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLSKGCINITSLNVIPSKKNSLDVLLFLFAGLGFGFGFALSIVVIWGIPIRKRSRVRQRAL

Gene3D: G3DSA:3.80.10.10
48-324 G3DSA:3.80.10.10

CRPDQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRCGHGDGRVTSLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDL

HMMPfam: PF08263
IPR013210
51-90 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DQESPLLRLKSSFSATDMSTAAFRSWRPGTDCCRWDGVRC

superfamily: SSF52047
99-450 SSF52047,LRR

SLDLGGRQLESRGGLDPAIFHLTSLEYLSLADNDFNGSPLPSSGFERLTELTHLSLRSTNITGVVPAGIGRLVNLVSLDLSTDFEIIDTFDDVYVFKMNSSLDAQQLAVPNLESLVANLSNLRELNLGLVNLSENGARWCNALVDSCPKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDLEGFVSPLIFKHKKLVTIDLYHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFS

HMMPfam: PF13855
246-305 LRR_8,Leucine rich repeat

PKLQVLRLSCCALSGPICATLPRLHSLSVIDLSFNSLPGLIPDFSNFPNLTALQLRRNDL

Gene3D: G3DSA:3.80.10.10
325-519 G3DSA:3.80.10.10

YHNPGIYGTLPNFSSDSHLENIYVGGTEFNGIIPSSIAELKSLKNLGLGATGFSGELPSSIGNLRSLKSLEISGFGLVGSIPSWVANLSSLTVLQFTNCGLSGSIPSSVGNLRNLGKLLLYNCSFSGKIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALR

superfamily: SSF52047
452-842 SSF52047,LRR

KIPSQILNLTQLEILSLHSNNFIGTVELTSMWKLLDLFVLDLSDNNLVVVDGKGNSSTASIPKLGALRLSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCLIEDVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDI

Gene3D: G3DSA:3.80.10.10
520-674 G3DSA:3.80.10.10

LSGCNVSKFPNFLRFQDEIEYLDLSYNHIDGAIPQWAWENWVKMDILSLKNNKFTSVGHDPFLPLSDMKALDLSENMFEGPIPIPRGYATVLDYSGNRFSSIPFKFTNYLSDVSFFKAGRNNFSGRIPPSFCSAMSLQLLDLSYNSFDGSIPSCL

Gene3D: G3DSA:3.80.10.10
677-810 G3DSA:3.80.10.10

DVDKLEVLNLKENKLRGEFPDNIKESCSFEALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNKFFGHVAQSLGEEKGTCEFQSARIVDLASNKFSGILPQEWFNKLKSMMI

HMMPfam: PF13855
707-762 LRR_8,Leucine rich repeat

ALDFSGNLIEGKLPRSLAVCKNLEVLNIGSNQINDSFPCWMGTLRKLQVLVLKSNK

superfamily: SSF52058
780-962 SSF52058,LRR

FQSARIVDLASNKFSGILPQEWFNKLKSMMIKDSNLTLVMDHDLPRMEKYDFTVALTYKGMDITFTKILRTLVFIDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPL

Gene3D: G3DSA:3.80.10.10
854-963 G3DSA:3.80.10.10

IDLSDNAFHGSLPEAIGELVLLNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELSGEIPQQLASLDFLTVLNLSYNKLEGEIPESPHFLTFSNSSFLGNDGLCGRPLS

HMMPfam: PF12799
875-910 LRR_4,Leucine Rich repeats (2 copies)

LNVLNISHNSLTGPIPPQLGRLTQLESLDISSNELS

HMMPfam: PF00560
IPR001611
923-940 LRR_1
Leucine-rich repeat

LTVLNLSYNKLEGEIPES


List of References

, National Institute of Agrobiological Sciences Rice Full-Length cDNA Project Team, Shoshi Kikuchi, Kouji Satoh, Toshifumi Nagata, Nobuyuki Kawagashira, Koji Doi, Naoki Kishimoto, Junshi Yazaki, Masahiro Ishikawa, Hitomi Yamada, Hisako Ooka, Isamu Hotta, Keiichi Kojima, Takahiro Namiki, Eisuke Ohneda, Wataru Yahagi, Kohji Suzuki, Chao Jie Li, Kenji Ohtsuki, Toru Shishiki, Foundation of Advancement of International Science Genome Sequencing & Analysis Group, Yasuhiro Otomo, Kazuo Murakami, Yoshiharu Iida, Sumio Sugano, Tatsuto Fujimura, Yutaka Suzuki, Yuki Tsunoda, Takashi Kurosaki, Takeko Kodama, Hiromi Masuda, Michie Kobayashi, Quihong Xie, Min Lu, Ryuya Narikawa, Akio Sugiyama, Kouichi Mizuno, Satoko Yokomizo, Junko Niikura, Rieko Ikeda, Junya Ishibiki, Midori Kawamata, Akemi Yoshimura, Junichirou Miura, Takahiro Kusumegi, Mitsuru Oka, Risa Ryu, Mariko Ueda, Kenichi Matsubara, RIKEN, Jun Kawai, Piero Carninci, Jun Adachi, Katsunori Aizawa, Takahiro Arakawa, Shiro Fukuda, Ayako Hara, Wataru Hashizume, Norihito Hayatsu, Koichi Imotani, Yoshiyuki Ishii, Masayoshi Itoh, Ikuko Kagawa, Shinji Kondo, Hideaki Konno, Ai Miyazaki, Naoki Osato, Yoshimi Ota, Rintaro Saito, Daisuke Sasaki, Kenjiro Sato, Kazuhiro Shibata, Akira Shinagawa, Toshiyuki Shiraki, Masayasu Yoshino, Yoshihide Hayashizaki, Ayako Yasunishi
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science: 2003, 301(5631);376-9
PubMed:12869764 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox