PRGDB00049748 (RGA2)

From PRG Wiki
Jump to: navigation, search
RGA2
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 13310460 (AF338966)
Gene Class NL
Domain Type NBS, LRR
Gene Species Brassica rapa

Comment?

Brassica rapa cultivar R500 disease resistance-like protein (RGA2) gene, partial cds.

DNA Sequence

TNAATAAGTGACAGGTTTGAAGTTGTGATATGGGTTGTTGTGTCTAAAAGTGCAACAGTCCGTAAGATTCAAAGAGACATAGCTCAAAAGGTTGGCCTTGTGGAGATGGGTTCGGGAGAGAAAGACGAGAACCAGAGAGCCCTTGACATCTACAATGTTCTTAGAAGAAGAAAGTTTGCGTTATTGTTGGATGACATATGGGAGAAAGTGGATTTAAAAGCGGTAGGAGTCCCCTACCCAACTAGAGATAATGGATGCAAGGTAGCATTCACAACTCGCTCTCGAGATGTGTGTGGCCGCATGGGGGTTGATGATCCAATGGAAGTTAGCTGTTTGCAACCAGACGAGTCATGGGATCTGTTCCAAAGGACAGTTGGGGAAAACACTCTGGGAAGTCATCC


Protein sequences

Name Description Sequence
disease resistance-like protein disease resistance-like protein [Brassica rapa].

XISDRFEVVIWVVVSKSATVRKIQRDIAQKVGLVEMGSGEKDENQRALDIYNVLRRRKFALLLDDIWEKVDLKAVGVPYPTRDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPDESWDLFQRTVGENTLGSHP


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
2-132 NB-ARC,NBS
NB-ARC

ISDRFEVVIWVVVSKSATVRKIQRDIAQKVGLVEMGSGEKDENQRALDIYNVLRRRKFALLLDDIWEKVDLKAVGVPYPTRDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPDESWDLFQRTVGENTLGS

HMMPanther: PTHR23155
6-85 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FEVVIWVVVSKSATVRKIQRDIAQKVGLVEMGSGEKDENQRALDIYNVLRRRKFALLLDDIWEKVDLKAVGVPYPTRDNG

HMMPanther: PTHR23155:SF119
6-85 PTHR23155:SF119,RFL1 (RPS5-LIKE 1)

FEVVIWVVVSKSATVRKIQRDIAQKVGLVEMGSGEKDENQRALDIYNVLRRRKFALLLDDIWEKVDLKAVGVPYPTRDNG

superfamily: SSF52540
6-127 SSF52540

FEVVIWVVVSKSATVRKIQRDIAQKVGLVEMGSGEKDENQRALDIYNVLRRRKFALLLDDIWEKVDLKAVGVPYPTRDNGCKVAFTTRSRDVCGRMGVDDPMEVSCLQPDESWDLFQRTVGE


List of References

M Fourmann, F Chariot, N Froger, R Delourme, D Brunel
Expression, mapping, and genetic variability of Brassica napus disease resistance gene analogues.
Genome: 2001, 44(6);1083-99
PubMed:11768212 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox