PRGDB00049779 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 190688725 (EU810765)
Gene Class Unknown
Domain Type
Gene Species Sorghum bicolor

Comment?

Sorghum bicolor clone BAC Sbb12448, complete sequence.

DNA Sequence

ATGTCGATGACGACGTCGATCTTGGGCGACCTGAGGGACCCCGAGAAGCCGCCGCGGGGCATCCTGGCCTCTCCCTACCTTCCTGGCAGTGGCAGCGGCAGCGGCAGTACAGAGGCTCCACTAACTGACTATGAGAAGCAGAAGATGGAACAAGTGATGCGGAATAGTCGGATCTTCCGCAGTCTTGGAATACAAGAGGCAGCAAATATTCTAAAAAATTCAAGACCAAAGGGCACTAATACTACCCGTGAAGACTCTGGCTCATTGTATCAACCTGAAGATGGTGAAGACGTTGAACAAGGAGCATTTGATAAGGAGGCCATGCTGGACTTGGAACCTGAAGTTAGCAAGAGTTCGACAAGAACATCAAAGAGAGTGATGGCAGTGGCACATCAAGGGCAAGACGATCCAGCAAGGATTACCAGGCAGAGGACAAGGGAATTGGCCTTAGCCGATGAAGTTCCAATAGTACACCCACAAGATGGTCGATGTATCACCAAGAGACACATGGGCAGAGATTTGGATATGATTTCAAGAGGGTTAAGAGCCAAGATCCCAGTGAACATCTCTGAAGGAAAATTGCGGCCAGAGGAGCCTTTGCAAGCTGCAAAACTAGCATCAGAGGCTGGTATTATTCTACGGGACCATGTTCCAATCTTCACTCACTGGAAGCATTATAAGGAGGATGCCGCCAAACCTCTTGTTAGAAACTACAATGATAAACTTAGTAGTCAATTCACCATTGACAAAGACGTTGTGCCGTGGAAACAACTCGTGGACATGTGGTCTAACCCAAAGCACAAGGAAAAATGTCTAAAAAACAAAGGCAGCCGTGAGCTAGTTCAGTATCACCAAATGACAGGATCTCGAAGCTATGTTGCTCAATGCTATGTCATGAAGCAAACTAAATTTAAGGATGCGCCACCAACTGCGATTGATATTTTCAAGGACACCCACTGCAGCAGCAAGTCAGGTTTTAATGAGCAAGCAATGGATGCCATTGCTCAAATGGAGGCCTACGTTGCTGAACCAACGGAAGAAGGGCAAGATCCAAAGACTCCTGTTCAAGCTATAGCTCATGTTATGCCAAAATCAACTTTCCTTCACAATGTTGGCATGCAGTCCGCAGCGATGAAGAGAAATGCCAAAGCTGCTGCAATGAATGATCGTGTGAATGAGCTTGAGAGTGAATTGCAAGCTGAGAAGAAGGGATCAGATGGACTAAGATCACAGCTGGCTGATGTGCAGAAGCAATTAGAGGATCAGAAAGAGGCAGCAAGGAAGAATGAAGAAGCAGCAAGAAGAACGAAGAAGAAACTGAGAAGCTGA


Protein sequences

Name Description Sequence
hypothetical protein hypothetical protein [Sorghum bicolor].

MSMTTSILGDLRDPEKPPRGILASPYLPGSGSGSGSTEAPLTDYEKQKMEQVMRNSRIFRSLGIQEAANILKNSRPKGTNTTREDSGSLYQPEDGEDVEQGAFDKEAMLDLEPEVSKSSTRTSKRVMAVAHQGQDDPARITRQRTRELALADEVPIVHPQDGRCITKRHMGRDLDMISRGLRAKIPVNISEGKLRPEEPLQAAKLASEAGIILRDHVPIFTHWKHYKEDAAKPLVRNYNDKLSSQFTIDKDVVPWKQLVDMWSNPKHKEKCLKNKGSRELVQYHQMTGSRSYVAQCYVMKQTKFKDAPPTAIDIFKDTHCSSKSGFNEQAMDAIAQMEAYVAEPTEEGQDPKTPVQAIAHVMPKSTFLHNVGMQSAAMKRNAKAAAMNDRVNELESELQAEKKGSDGLRSQLADVQKQLEDQKEAARKNEEAARRTKKKLRS

Domains

Domain Start-End Description Sequence

HMMPfam: PF03004
IPR004252
255-349 Transposase_24
Transposase, Ptta/En/Spm, plant

WKQLVDMWSNPKHKEKCLKNKGSRELVQYHQMTGSRSYVAQCYVMKQTKFKDAPPTAIDIFKDTHCSSKSGFNEQAMDAIAQMEAYVAEPTEEGQ


List of References

Ervin D Nagy, Tso-Ching Lee, Wusirika Ramakrishna, Zijun Xu, Patricia E Klein, Phillip SanMiguel, Chiu-Ping Cheng, Jingling Li, Katrien M Devos, Keith Schertz, Larry Dunkle, Jeffrey L Bennetzen
Fine mapping of the Pc locus of Sorghum bicolor, a gene controlling the reaction to a fungal pathogen and its host-selective toxin.
Theor. Appl. Genet.: 2007, 114(6);961-70
PubMed:17356869 WorldCat.org DOI (P p)

Ervin D Nagy, Jeffrey L Bennetzen
Pathogen corruption and site-directed recombination at a plant disease resistance gene cluster.
Genome Res.: 2008, 18(12);1918-23
PubMed:18719093 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox