PRGDB00049798 (AT4g09450)

From PRG Wiki
Jump to: navigation, search
AT4g09450
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7267546 (AL161514)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 26.

DNA Sequence

ATGGACGTTGACATGGAACGACTGAATCCTCTATTGAGCATCGAATCTGAGAATGAGGTTCGTATGATCGGAATCTGGGGAATGGGAGGCATAGGCAAAACCACCATTGCCAAGTGTCTCTATGAAGAATATTCGCGCCGATTTGTTCACTATTGTTTCATAGAAAACGTTAGGATTTTTGCAAAGAATGGCCTCCCATATTTGCAGGAAAAGCTTCTATCTGAAATCCGAGGCAAAAAGCAAGAGACCTTATGGAGCGTGGAGAAGGGATGCAGACTTATCAAGTCGAAGCTCAAGGAAAAAAATTTCCTTGTCCTTGACGATGTGGACAATGTGGACCAGCTGCATGCCCTAGCAAAAGAGACGAGCTGGTTTGGACCAGGGAGCCGAATCATCATAACTACACGAGACTTTGGCTTACTCTACTCCTTTGGAGTGAGATTATTATACCGTGTTAGCTTTTTGGATGACAATGATGCTATCAAAGTCTTTAAACATGTTGCTTTTGACGGAGGGCAACCTCCTTTTGATGTCTACCATCAATTCTCAGTCCGTGCTTCTAGGCTTGCTCAAGGCCTTCCTTCAGCCCTTGAGGCTTTTGGCGCGTTGGGCATTCTTGAAACAGTTCCTCAAAAACGTATCAAGGATATTTTAAAAACTAGCTATGACGGTTTAGACGAGGAAGAGCAAGCTGCGTTCCTTCATGTTGCATGTCTATTCAATGGAGACTCTGTCCACCGGGTAAATGCCCTTATCGATGATGGTGACATGAGGATAAAAGCTTTAGAAGTGAAGTCTCTCATAGACATATCACTTGATGGATGCATTACATTGCATGTCTTGATAGAACAAGCGGCAAGAGAAATTGATACAGCAATGGTTGAAGGTGTAGCACTTCACATGTGTGAGATGATACACGTGTTGCCTATCGACGGAAATATTCTTAACACTATCAACAATCTCAAATTCTTCAAGGCTTTCACGCATATAGAGGTTATGAATTCCAAATTGCAGTTTCTTCCAGGCACAGCTAACAATTCAGGGGGCCTTGGTCAGTTGAGGAGACTAGATGTTACTGGCTCTAAGAATCTGAGAGAAATTCCAGATCTCTCGAGGACCATGCTGCTCGAGGAGTTGATAATGAAAGGCTGCACAAGATTGGAGAAAACTCTAGATATCAGAAAAGGCTGTCCTTCCAGAACGTGGACTAAGGCGACGCCGACAAATAATATTGAGGCTTCCCAGAGGAGTAAAGAAGCTGAGTTCTCTTGCAAACCTATCTATAGAAGGGAAGATACACATCGGCTTGTGGCATCTCACGGGAACCGTAGAGCACCTCTCCTTTATTCCGAGCAAAAAATCCCTGATGAATTGGTAATGGTGCCAAAGAAAAGATTTCCGATCATCTCAAGCTTTTATGATCTTAAATCTCTCAGCATCATGCGGTTTAGCCACATTGCAGATGGTACCCCCTTCCGTTGCATTAGCTTCTCAGGTTTCCAGTGCTTGGTAGAGTTGAATCTGATCAACTTAAACATCCAGAAAATCCCAGACAACATTGGTCTAATGCAGTCACTAGAGAAAGTGGACCTCAGCGGAAATGATTTCAGGAATCTACCCGCATCAACAAAGAACCTTTCGAAGTTGAAATACGCGAGGCTCTCTAATTGCATCAAACTCGAGGCATTTGTAGAGCTGACTGAGTTGCAGACGCTCAAGCTTTCTGGTTGTACGAACCTCGAATCTCTGCTGGAACTTCCTTATGCGGTTCAAGATGTAGGCAGATTCTGTTTGCTAGCGCTTGAGCTTGATAACTGCAAGAATCTCCAAGCATTATCAGAACAGCTAAGCCATTTCAGCAATTTAATACACTTGGACCTAAGCAGCCACGACTTTGAGAAACTCAAATCAGTGGAAGAGCTTCCACTAAACCTCAAGCATCTCTACGCACACGGCTGTGATTCCCTGGAAAGTGTCGACCTTTCCCCAAAGCATTCAATCAAACACCTCGATCTTAGCCATTGCTTCGGTTTGCAACAAGATGAGCAACAGATTACACAATTTCTAAACGACAAGTGTAGCCAAGAGGTTTCACAAAGATTTCTTTGCTTACCAGGAACTGAAGTACCCAGAAATTTCGATAATCAGTCACATGGGACATCGACGAAGATCAGCTTGTTTACACCGACACTTCTGAGTTTCGCTGCCTGTATCTTGATTTCTTGCGAGAGGTCCTTCTACCTCCAATTCCCAGCGTTTAGTTATGATTGGAACCGCAAAGATGATGAAGTAATTTCGATTAACCTCACACCAAATCTCAATCTTTCATCGGAGATTGAGGAAGAAGAGACTGTAACATCACATCACCTGGTTATCATCCACGTACCCAGTAGCATAAACACCGACAAAATCGAAGATTTGCGACTCGAATCCTCTCTTCAATTTCCAGAGGAGTTTCAGTTTTCACCCTGCGAGATAAGAGCTTGTGGAATTCGCATGGTTGACGAAGAGACTAAATGTCTGGAGAGCTCACCTCTTATGCCACTATTGGAGAAGAAATAA


Protein sequences

Name Description Sequence
putative protein putative protein [Arabidopsis thaliana].

MDVDMERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGILETVPQKRIKDILKTSYDGLDEEEQAAFLHVACLFNGDSVHRVNALIDDGDMRIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQRFLCLPGTEVPRNFDNQSHGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFSYDWNRKDDEVISINLTPNLNLSSEIEEEETVTSHHLVIIHVPSSINTDKIEDLRLESSLQFPEEFQFSPCEIRACGIRMVDEETKCLESSPLMPLLEKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-811 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDVDMERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGILETVPQKRIKDILKTSYDGLDEEEQAAFLHVACLFNGDSVHRVNALIDDGDMRIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQRFLCLPGTEVPRNFDNQSHGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFSYDWNRKDDEVISINLTPNLNLSSEIEEEETVTSHHLVIIHVPSSINTDKIEDLRLES

HMMPanther: PTHR23155:SF345
1-811 PTHR23155:SF345

MDVDMERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGILETVPQKRIKDILKTSYDGLDEEEQAAFLHVACLFNGDSVHRVNALIDDGDMRIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQRFLCLPGTEVPRNFDNQSHGTSTKISLFTPTLLSFAACILISCERSFYLQFPAFSYDWNRKDDEVISINLTPNLNLSSEIEEEETVTSHHLVIIHVPSSINTDKIEDLRLES

HMMPfam: PF00931
IPR002182
5-203 NB-ARC,NBS
NB-ARC

MERLNPLLSIESENEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGAL

superfamily: SSF52540
18-206 SSF52540

NEVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSFLDDNDAIKVFKHVAFDGGQPPFDVYHQFSVRASRLAQGLPSALEAFGALGIL

HMMSmart: SM00382
IPR003593
19-154 AAA,NBS
AAA+ ATPase domain

EVRMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGVRLLYRVSF

Gene3D: G3DSA:3.40.50.300
21-146 G3DSA:3.40.50.300

RMIGIWGMGGIGKTTIAKCLYEEYSRRFVHYCFIENVRIFAKNGLPYLQEKLLSEIRGKKQETLWSVEKGCRLIKSKLKEKNFLVLDDVDNVDQLHALAKETSWFGPGSRIIITTRDFGLLYSFGV

FPrintScan: PR00364
IPR000767
22-37 DISEASERSIST
Disease resistance protein

MIGIWGMGGIGKTTIA

FPrintScan: PR00364
IPR000767
96-110 DISEASERSIST
Disease resistance protein

SKLKEKNFLVLDDVD

FPrintScan: PR00364
IPR000767
190-204 DISEASERSIST
Disease resistance protein

AQGLPSALEAFGALG

superfamily: SSF52058
258-700 SSF52058,LRR

RIKALEVKSLIDISLDGCITLHVLIEQAAREIDTAMVEGVALHMCEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCPSRTWTKATPTNNIEASQRSKEAEFSCKPIYRREDTHRLVASHGNRRAPLLYSEQKIPDELVMVPKKRFPIISSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHCFGLQQDEQQITQFLNDKCSQEVSQR

Gene3D: G3DSA:3.80.10.10
302-398 G3DSA:3.80.10.10

CEMIHVLPIDGNILNTINNLKFFKAFTHIEVMNSKLQFLPGTANNSGGLGQLRRLDVTGSKNLREIPDLSRTMLLEELIMKGCTRLEKTLDIRKGCP

Gene3D: G3DSA:3.80.10.10
470-675 G3DSA:3.80.10.10

SSFYDLKSLSIMRFSHIADGTPFRCISFSGFQCLVELNLINLNIQKIPDNIGLMQSLEKVDLSGNDFRNLPASTKNLSKLKYARLSNCIKLEAFVELTELQTLKLSGCTNLESLLELPYAVQDVGRFCLLALELDNCKNLQALSEQLSHFSNLIHLDLSSHDFEKLKSVEELPLNLKHLYAHGCDSLESVDLSPKHSIKHLDLSHC

HMMPfam: PF00560
IPR001611
525-546 LRR_1
Leucine-rich repeat

SLEKVDLSGNDFRNLPASTKNL

FPrintScan: PR00364
IPR000767
564-580 DISEASERSIST
Disease resistance protein

VELTELQTLKLSGCTNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox