PRGDB00049799 (AT4g08530)

From PRG Wiki
Jump to: navigation, search
AT4g08530
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 7267469 (AL161511)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana DNA chromosome 4, contig fragment No. 23.

DNA Sequence

ATGGCTTCTTCTTCTTCTCATAACTGGGTTTACGACGTTTTCACAAGCTTCAGCGGGGAAGATATCCGTGTAACTTTCCTCACCCACTTTCTCAAGGAGCTTGATCGAAAAATGATTATTGCTTTCAAAGACAATGAGATTGAGAGAGGGAACTCGATCGGTACCGAGCTTATACAGGCGATAAAGGATTCGAGGATCGCGGTGGTTGTGTTCTCCAAAAAATACTCTTCTTCGAGTTGGTGTTTGAATGAGTTGGTAGAGATTGTGAATTGCAAGGAAATTGTGATACCAGTTTTCTATGATTTAGATCCTTCTGATGTTAGGAAACAAGAGGGAGAATTTGGAGAGTCTTTTAAAGAGACTTGCAAGAACAGAACAGATTATGAGATACAACGTTGGGGCCAAGCGTTGACCAATGTAGCAAATATTGCTGGATATCACACTAGGAAACCGAATAACGAAGCAAAATTGATTGAAGAAATCACTAATGATGTTTTGGATAAACTAATGAAGTTAACACCATCGAAAGATTTTGATGAATTTTTTGGCATCGAAGATCATATCAAAGAGCTGAGTTTATTATTGTGCTTGGAATCTGAGGAAGTGAGAATGGTTGGGATATGGGGTCCTACGGGGATTGGTAAGACAACCATTGCAAGAGCTTTATTTAATCGAATCTACCGTCACTTCCAAGGTAGGGTTTTTATAGACAGAGCTTTTATATCTAAGAGTATGGCTATTTATAGTAGAGCAAACTCGGACGACTATAACTTGAAGTTGCATTTGCAAGAAAAGTTGTTGTCTAAACTTTTAGACAAAAAAAACTTGGAGATAAATCACCTAGATGCTGTGAAAGAGAGGCTAAGGCAAATGAAAGTTCTTATCTTTATTGATGATTTGGATGATCAAGTGGTGCTAGAAGCCTTAGCCTGTCAAACTCAGTGGTTTGGGCATGGAAGTAGAATCATTGTGATTACAAAAGATAAGCATCTCTTAAGGGCTTATGGGATTGATCATATATATGAGGTTCTTCTCCCGTCGAAAGACCTTGCTATTAAGATGTTTTGTCGATCTGCTTTTAGGAAAGACTCTCCACCCAATGGTTTTATAGAACTTGCTTATGATGTTGTAAAACGTGCAGGTAGTCTTCCTTTGGGTCTTAACATTTTAGGTTCGTATTTACGGGGTAGGAGTAAGGAGGATTGGATAGATATGATGCCGGGGCTTCGTAATAAACTAGACGGGAAAATTCAGAAAACACTTAGAGTCAGCTACGACGGGTTGGCTAGCGAAGACGATCAAGCGATATTTCGTCATATTGCATGTATTTTTAATTTTGAGGCATGCAGTGACATCAAGAAACTGCTTGAAGATAGTGGCTTGAATGTCACTAATGGGCTTATAAACCTTGTCGATAAGTCCCTCATACGTATAGAACCAAAGCAGAAAACTGTGGAGATGCATTGTTTGTTACAAGAAACGGCTAGAGAAATTATTCGTGCACAGTCTTTTGATGATCCTGGAAAACGAGAATTCCTTGTGGATGGGAAGGATATTGCTGATGTCCTAGATAATTGCAGTGGTACAAGAAAAGTCTTAGGTATATCATTGGATATGGATGAGATTGAAGAGTTGCATCTACAAGTAGACGCCTTCAAAAAGATGCTTAATCTCCGTTTTCTAAAACTTTACACAAATACAAATATATCAGAAAAAGAAGACAAATTGCTCTTACCTAAAGAATTCAACTATTTACCCAATACACTCAGATTACTAAGTTGGCAAAGGTTTCCAATGAGATGTATGCCTTCTGATTTTTTTCCTAAATATCTTGTTAAACTTCTAATGCCGGGGAGCAAGCTCGAGAAGCTGTGGGACGGAGTAATGCCGCTTCAATGCCTCAAGAATATGAATTTGTTTGGATCTGAAAACCTTAAAGAATTCCCAAATCTCTCGCTAGCAACAAACCTAGAGACATTGTCTCTTGGCTTTTGCTTGAGTTTGGTTGAGGTTCCTTCCACTATTGGGAATCTCAATAAACTTACGTATTTGAACATGTCAGGATGCCATAATTTGGAGAAATTTCCGGCTGATGTCAACCTCAAATCTCTCTCTGACCTCGTTCTCAATGGATGCTCACGTTTGAAGATTTTTCCCGCTATATCAAGCAACATCTCAGAGCTATGCCTAAACAGTTTAGCAGTTGAGGAATTCCCATCCAACTTGCATCTAGAGAATCTTGTTTATCTTTTAATTTGGGGAATGACGAGTGTCAAGTTGTGGGATGGCGTGAAGGTGCTTACATCCCTTAAAACTATGCATTTGCGAGATTCTAAAAACCTGAAAGAAATCCCAGATCTTTCAATGGCATCGAATCTTCTGATACTAAATCTTGAACAATGCATAAGTATTGTGGAGCTTCCTTCCTCTATTAGAAATCTCCATAACTTGATAGAGTTGGACATGTCAGGATGCACAAACCTGGAGACTTTTCCAACTGGCATCAACCTTCAATCTCTAAAACGCATAAATCTAGCTAGATGCTCACGGTTAAAGATTTTTCCGGATATCTCAACCAACATCTCAGAGCTTGATCTAAGCCAAACAGCGATTGAAGAAGTTCCTTTGTGGATCGAGAACTTCTCTAAGCTCAAATACTTAATAATGGGAAAATGTAACATGTTGGAATATGTATTCCTAAACATTTCCAAACTGAAACATCTCAAGAGCGTTGACTTTTCAGACTGTGGGATATTGTCTAAAGCAGACATGTACATGCTACAAGTACCCAATGAAGCTTCCTCTTCACTTCCAATTAATTGTGTCCAAAAAGCTGAGCTTATATTCATCAACTGCTACAAGCTGAATCAAAAAGCTCTCATTCGCCAACAATTTTTTCTGAAGAAAATGATTTTGCCAGGTGAAGAAGTGCCTTTTTATTTCACTCACCAAACAATAGGAAGCTCTATTGGTATCCCTCTACTTCACATATTACTTTCTCAACAATACTTCAGATTTAAGGCTTGTGTTGTGGTTGATCCCAAGTTTGTGTTCCCAGCTCGTCGTTATCACGTAAACATCCAGGTTTCTTGTCGATTCAAAGGCATATATGGGAACTACTTTGATTATGCTGATCAGCCACATTGCTTCTCACCATCTCAGACGGACAATTATGTGTATGTATTTGATTGTTGTTTCCCTCTTAACAAAGACAATGCTCCTCTAGCTGAACTCGACTATGATCATGTGGATATAGAATTTCATCTTGATGATAACTACAATCACCACAAAATAAAAGGATGCGGTATACGACTCTCTGAGGATGATGAAAGCAGTGACGATGATGATGACCTAAGCAGTGAAACTGATTATAGTGATGAGTGTGAAGATAGCGATGATAGTGATCTTGGAAATGAAATTGATTACAGTGAAGACTATGAAGACCGCGATACTAGTGATCTTGGAAATGAAACTGATTACAGTGAAGAGTATGAAGACCATGATAGTAGTGATCTTGGCAATGAGTATGACTATAATGAAGAGTGTGAAGAAAATGATGATAATGATCTTGTACTTGAGACTGATCACAATGAAGAGTGTCAAGACAACGATGTGGAGAAGAAGAGAAGTAGTAAGCGAATGCGGGTAAATTTTTATATAGTTCACAATTCTTTTCCAAGATCAAACGTAAACTTTTTCATATAG


Protein sequences

Name Description Sequence
putative protein putative protein [Arabidopsis thaliana].

MASSSSHNWVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGYHTRKPNNEAKLIEEITNDVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILSKADMYMLQVPNEASSSLPINCVQKAELIFINCYKLNQKALIRQQFFLKKMILPGEEVPFYFTHQTIGSSIGIPLLHILLSQQYFRFKACVVVDPKFVFPARRYHVNIQVSCRFKGIYGNYFDYADQPHCFSPSQTDNYVYVFDCCFPLNKDNAPLAELDYDHVDIEFHLDDNYNHHKIKGCGIRLSEDDESSDDDDDLSSETDYSDECEDSDDSDLGNEIDYSEDYEDRDTSDLGNETDYSEEYEDHDSSDLGNEYDYNEECEENDDNDLVLETDHNEECQDNDVEKKRSSKRMRVNFYIVHNSFPRSNVNFFI

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
1-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

MASSSSHNWVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGY

Gene3D: G3DSA:3.40.50.10140
7-142 G3DSA:3.40.50.10140

HNWVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVAN

ProfileScan: PS50104
IPR000157
9-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WVYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANI

HMMSmart: SM00255
IPR000157
10-143 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VYDVFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANI

HMMPfam: PF01582
IPR000157
13-138 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFTSFSGEDIRVTFLTHFLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALT

HMMPanther: PTHR11017
30-1188 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGYHTRKPNNEAKLIEEITNDVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILSKADMYMLQVPNEASSSLPINCVQKAELIFINCYKLNQKALIRQQFFLKKMILPGEEVPFYFTHQTIGSSIGIPLLHILLSQQYFRFKACVVVDPKFVFPARRYHVNIQVSCRFKGIYGNYFDYADQPHCFSPSQTDNYVYVFDCCFPLNKDNAPLAELDYDHVDIEFHLDDNYNHHKIKGCGIRLSEDDESSDDDDDLSSETDYSDECEDSDDSDLGNEIDYSEDYEDRDTSDLGNETDYSEEYEDHDSSDLGNEYDYNEECEENDDN

HMMPanther: PTHR11017:SF20
30-1188 PTHR11017:SF20,SUBFAMILY NOT NAMED

FLKELDRKMIIAFKDNEIERGNSIGTELIQAIKDSRIAVVVFSKKYSSSSWCLNELVEIVNCKEIVIPVFYDLDPSDVRKQEGEFGESFKETCKNRTDYEIQRWGQALTNVANIAGYHTRKPNNEAKLIEEITNDVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILSKADMYMLQVPNEASSSLPINCVQKAELIFINCYKLNQKALIRQQFFLKKMILPGEEVPFYFTHQTIGSSIGIPLLHILLSQQYFRFKACVVVDPKFVFPARRYHVNIQVSCRFKGIYGNYFDYADQPHCFSPSQTDNYVYVFDCCFPLNKDNAPLAELDYDHVDIEFHLDDNYNHHKIKGCGIRLSEDDESSDDDDDLSSETDYSDECEDSDDSDLGNEIDYSEDYEDRDTSDLGNETDYSEEYEDHDSSDLGNEYDYNEECEENDDN

superfamily: SSF52540
164-417 SSF52540

DVLDKLMKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKI

Gene3D: G3DSA:3.40.50.300
170-335 G3DSA:3.40.50.300

MKLTPSKDFDEFFGIEDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAY

HMMPfam: PF00931
IPR002182
185-443 NB-ARC,NBS
NB-ARC

EDHIKELSLLLCLESEEVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPSKDLAIKMFCRSAFRKDSPPNGFIELAYDVVKRAGSLPLGLNILGSYLRGRSKEDWIDMMPGLRNKLDGKIQKTLRVSYDGLASEDDQAIFRHIACI

HMMSmart: SM00382
IPR003593
201-347 AAA,NBS
AAA+ ATPase domain

EVRMVGIWGPTGIGKTTIARALFNRIYRHFQGRVFIDRAFISKSMAIYSRANSDDYNLKLHLQEKLLSKLLDKKNLEINHLDAVKERLRQMKVLIFIDDLDDQVVLEALACQTQWFGHGSRIIVITKDKHLLRAYGIDHIYEVLLPS

FPrintScan: PR00364
IPR000767
204-219 DISEASERSIST
Disease resistance protein

MVGIWGPTGIGKTTIA

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

RLRQMKVLIFIDDLD

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

AGSLPLGLNILGSYL

superfamily: SSF46785
415-524 SSF46785

GKIQKTLRVSYDGLASEDDQAIFRHIACIFNFEACSDIKKLLEDSGLNVTNGLINLVDKSLIRIEPKQKTVEMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLD

superfamily: SSF52058
486-919 SSF52058,LRR

EMHCLLQETAREIIRAQSFDDPGKREFLVDGKDIADVLDNCSGTRKVLGISLDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYLLIWGMTSVKLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGIL

Gene3D: G3DSA:3.80.10.10
537-750 G3DSA:3.80.10.10

LDMDEIEELHLQVDAFKKMLNLRFLKLYTNTNISEKEDKLLLPKEFNYLPNTLRLLSWQRFPMRCMPSDFFPKYLVKLLMPGSKLEKLWDGVMPLQCLKNMNLFGSENLKEFPNLSLATNLETLSLGFCLSLVEVPSTIGNLNKLTYLNMSGCHNLEKFPADVNLKSLSDLVLNGCSRLKIFPAISSNISELCLNSLAVEEFPSNLHLENLVYL

HMMPfam: PF07725
IPR011713
610-628 LRR_3
Leucine-rich repeat 3

YLVKLLMPGSKLEKLWDGV

HMMPfam: PF00560
IPR001611
680-698 LRR_1
Leucine-rich repeat

KLTYLNMSGCHNLEKFPAD

Gene3D: G3DSA:3.80.10.10
759-920 G3DSA:3.80.10.10

KLWDGVKVLTSLKTMHLRDSKNLKEIPDLSMASNLLILNLEQCISIVELPSSIRNLHNLIELDMSGCTNLETFPTGINLQSLKRINLARCSRLKIFPDISTNISELDLSQTAIEEVPLWIENFSKLKYLIMGKCNMLEYVFLNISKLKHLKSVDFSDCGILS

FPrintScan: PR00364
IPR000767
812-828 DISEASERSIST
Disease resistance protein

RNLHNLIELDMSGCTNL

HMMPfam: PF00560
IPR001611
816-833 LRR_1
Leucine-rich repeat

NLIELDMSGCTNLETFPT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox