PRGDB00049810 (leucine-rich repeat family protein)

From PRG Wiki
Jump to: navigation, search
leucine-rich repeat family protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186488080 (NM_103084)
Gene Class RLP
Domain Type LRR, LRR, LRR, LRR, LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat family protein (AT1G33610) mRNA, complete cds.

DNA Sequence

ATGAATTCACTCTCCTTCACTCTCTTCATATTTTCTGTCATTACCTTTCTACAATGTTTAAGTTCAACCGGAGCTGCCACGTGTCATCCTGATGACGAGGCGGGTCTTTTAGCTTTCAAATCCGGTATAACACAAGATCCTTCGGGCATGCTCAGCTCTTGGAAGAAGGGTACTTCTTGCTGCTCGTGGAAAGGTATCATTTGCTTTAACAGTGACCGCGTCACCATGCTTGAACTAGTAGGATTTCCCAAAAAACCCGAACGTTCCCTCTCCGGCACTCTCTCACCGTCGCTAGCCAAACTCCAGCACCTAAGCGTGATTAGCTTAGGAGGTCATGTGAACATCACTGGATCTTTTCCTAAGTTCCTTCTCCAATTACCAAAGCTAAGGTACGTTGACATCCAAAATAACCGTCTCTCCGGTCCACTTCCGGCTAACATCGGCGTGCTAAGCTTGTTGGAAGAAATCTTTCTTCAAGGAAATAAGTTCACCGGTCCCATCCCGAACTCGATATCGAATCTAACTCGATTATCTTATCTCATTTTTGGCGGTAATCTCCTAACCGGGACTATACCCTTAGGGATTGCTAATCTCAAGCTCATGCAGAATCTGCAACTCGGCGACAACCGCCTCTCTGGCACCATCCCGGATATTTTCGAATCCATGAAGTTGCTCAAATTTCTCGATCTCTCCAGCAACGAATTCTACGGGAAACTTCCTCTATCGATTGCTACACTGGCACCGACACTCCTGGCCCTCCAAGTGAGCCAGAACAATCTCTCTGGGGCGATCCCAAACTATATATCAAGATTCAACAAGCTTGAAAAGTTAGATCTCTCCAAGAACCGGTTCTCGGGGGTTGTGCCTCAAGGTTTCGTCAATCTCACCAATATTAACAATCTTGATCTCTCTCACAATCTTCTAACCGGTCAATTTCCTGACTTGACCGTCAACACTATCGAATATCTTGATCTCTCTTACAACCAATTTCAACTAGAAACGATTCCACAATGGGTGACCTTGTTGCCGAGCGTCTTCTTGTTGAAGCTAGCAAAATGCGGGATCAAGATGAGCTTAGATGATTGGAAGCCAGCGGAACCGTTGTACTACCATTACATTGATTTGTCGAAAAACGAGATCTCAGGGAGTCTAGAAAGGTTCTTGAACGAGACGAGGTATCTGCTTGAGTTTCGGGCGGCGGAGAACAAACTTCGATTCGATATGGGGAACCTAACGTTTCCGAGGACACTAAAAACTTTGGATCTGTCAAGGAACTTGGTATTTGGTAAGGTGCCTGTCACGGTGGCTGGTCTACAAAGACTAAACTTAAGTCAAAACCATCTTTGTGGAGAACTTCCTACGACAAAGTTCCCGGCTAGCGCCTTCGCCGGTGCTATTATCTTTCTCCGGTGTTTTCGTTCCACCGGAGCTGCCACGTGTGATCCTGATGACGAAGCGGGTCTTTTAGGTTTCAAATCGGGTATAACCAAAGATCCTTCGGGCATTCTCAGCTCATGGAAGAAAGGTACTGACTGCTGCTTTTGGAGCGGTGTCTTTTGCGTCAACAACGACCGCGTCACACAACTAAGTGTGGATGGAGACTTTTCTCTTGACGGAAACTCTCCCTCCGGCACTATCTCGCCGATGCTGGCCAAACTTCAACACCTCGAGAGGATTCTTCTCACCTCTCTTCGAAAGATTACTGGTCCTTTTCCTCAATTCATTTTCCGATTACCAAAGCTAAATTACATAAACATCCAAGGTTGCCTTCTCTCTGGTCCCCTTCCAGCCAACATCGGCGAGCTAAGTCAATTGAAAACTTTAGTTATCGACGGAAACATGTTCACGGGTCATATTCCAAGTTCGATAGCCAATTTGACTCGGTTAACTTGGCTTAACCTCGGCAACAACCGCCTCTCTGGCACCATTCCAAACATATTTAAATCCATGAAAGAGCTCAATTCTCTTGATCTCTCCCGCAACGGATTTTTCGGGAGACTTCCTCCGTCGATTGCTTCGCTTGCACCAACTCTCTATTACCTCGATCTGAGCCAGAACAATCTCTCGGGGACGATCCCAAACTATTTATCAAGGTTTGAGGCGCTCTCCACATTGGTACTCTCGAAGAATAAGTACTCGGGGGTCGTGCCAATGAGTTTCACCAATCTGATCAACATTACCAATCTTGATCTCTCCCACAATCTTCTAACTGGTCCATTCCCTGTATTGAAAAGCATTAACGGCATTGAATCTCTGGATTTGTCGTACAACAAGTTTCACCTGAAAACGATTCCAAAATGGATGATATCGTCACCATCCATCTACTCATTGAAGTTGGCAAAATGTGGGCTGAAGATAAGCTTAGATGATTGGAAGCTAGCAGGGACCTACTACTATGATTCCATCGATCTGTCTGAAAACGAGATCTCAGGGAGTCCGGCTAAGTTCCTCAGCCAGATGAAGTATCTGATGGAGTTCCGAGCGGCAGGGAACAAACTCCGATTCGATTTGGGGAAGCTGACGTTTGTGAGGACTCTTGAAACCTTGGATTTGTCAAGGAACTTGATATTCGGGAGAGTGCTGGCAACATTTGCTGGACTGAAGACAATGAACGTGAGTCAAAACCATCTTTGCGGAAAACTTCCGGTGACAAAGTTCCCGGCCAGTGYGTTTGCGGGTAACGACTGTCTTTGTGGCTCTCCACTTTCTCCTTGTAAAGTGTAG


Protein sequences

Name Description Sequence
leucine-rich repeat family protein leucine-rich repeat family protein [Arabidopsis thaliana].

MNSLSFTLFIFSVITFLQCLSSTGAATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPTTKFPASAFAGAIIFLRCFRSTGAATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQMKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCKV


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-907 FAMILY NOT NAMED,FAMILY NOT NAMED

MNSLSFTLFIFSVITFLQCLSSTGAATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPTTKFPASAFAGAIIFLRCFRSTGAATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQMKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCKV

HMMPanther: PTHR24420:SF509
1-907 LEUCINE-RICH REPEAT FAMILY PROTEIN

MNSLSFTLFIFSVITFLQCLSSTGAATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPTTKFPASAFAGAIIFLRCFRSTGAATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQMKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCKV

superfamily: SSF52058
26-365 L domain-like,LRR

ATCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPA

Gene3D: G3DSA:3.80.10.10
27-246 no description

TCHPDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIICFNSDRVTMLELVGFPKKPERSLSGTLSPSLAKLQHLSVISLGGHVNITGSFPKFLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNLLTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATL

HMMPfam: PF08263
IPR013210
30-68 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKSGITQDPSGMLSSWKKGTSCCSWKGIIC

HMMSmart: SM00369
IPR003591
126-150 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LPKLRYVDIQNNRLSGPLPANIGVL

HMMSmart: SM00369
IPR003591
198-221 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKLMQNLQLGDNRLSGTIPDIFES

Gene3D: G3DSA:3.80.10.10
248-454 no description

PTLLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLTVNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELPT

HMMPfam: PF13855
250-308 LRR_8,Leucine rich repeat

LLALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLL

HMMSmart: SM00369
IPR003591
271-294 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FNKLEKLDLSKNRFSGVVPQGFVN

superfamily: SSF52058
319-453 L domain-like,LRR

TIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLDDWKPAEPLYYHYIDLSKNEISGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFGKVPVTVAGLQRLNLSQNHLCGELP

HMMSmart: SM00369
IPR003591
435-464 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VAGLQRLNLSQNHLCGELPTTKFPASAFAG

HMMPfam: PF00560
IPR001611
438-457 LRR_1
Leucine-rich repeat

LQRLNLSQNHLCGELPTTKF

superfamily: SSF52058
478-794 L domain-like,LRR

ATCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKCGLKISLDDWKLA

Gene3D: G3DSA:3.80.10.10
479-774 no description

TCDPDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFCVNNDRVTQLSVDGDFSLDGNSPSGTISPMLAKLQHLERILLTSLRKITGPFPQFIFRLPKLNYINIQGCLLSGPLPANIGELSQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRNGFFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLLTGPFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSI

HMMPfam: PF08263
IPR013210
482-520 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLGFKSGITKDPSGILSSWKKGTDCCFWSGVFC

HMMPfam: PF13855
603-661 LRR_8,Leucine rich repeat

SQLKTLVIDGNMFTGHIPSSIANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRN

HMMSmart: SM00369
IPR003591
626-649 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTRLTWLNLGNNRLSGTIPNIFKS

HMMSmart: SM00369
IPR003591
650-674 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MKELNSLDLSRNGFFGRLPPSIASL

HMMPfam: PF13855
676-736 LRR_8,Leucine rich repeat

PTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINITNLDLSHNLL

Gene3D: G3DSA:3.80.10.10
775-881 no description

YSLKLAKCGLKISLDDWKLAGTYYYDSIDLSENEISGSPAKFLSQMKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKL

superfamily: SSF52058
801-906 L domain-like,LRR

SIDLSENEISGSPAKFLSQMKYLMEFRAAGNKLRFDLGKLTFVRTLETLDLSRNLIFGRVLATFAGLKTMNVSQNHLCGKLPVTKFPASXFAGNDCLCGSPLSPCK

HMMSmart: SM00369
IPR003591
843-866 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

VRTLETLDLSRNLIFGRVLATFAG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox