PRGDB00049820 (leucine-rich repeat family protein)

From PRG Wiki
Jump to: navigation, search
leucine-rich repeat family protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 22330528 (NM_148645)
Gene Class Unknown
Domain Type LRR, LRR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat family protein (AT1G69545) mRNA, complete cds.

DNA Sequence

ATGGATTTACGTTATTCTAGTCATTTGAAAGAGCTTCCTAATCTCTCAACAGCCATTAATCTCCTAGAAATGGTTCTTTCCGATTGCTCAAGTTTGATAGAGCTTCCTTCCTCTATTGGGAATGCTACTAATATCAAGAGCTTAGATATACAAGGTTGCTCAAGCCTATTGAAGCTTCCCTCATCTATTGGAAATCTCATTACTCTCCCGAGATTGGATCTCATGGGATGCTCAAGCCTAGTGGAGCTTCCCTCATCTATCGGAAATCTCATTAATCTCCCGAGATTGGATCTCATGGGATGCTCAAGCCTAGTGGAGCTTCCCTCATCTATCGGAAATCTCATTAATCTCGAGGCTTTTTATTTCCACGGATGTTCAAGTTTACTGGAGCTTCCGTCATCTATTGGAAATCTCATTAGTCTCAAGATACTATACCTAAAAAGAATTTCAAGCCTAGTGGAGATTCCTTCATCTATTGGAAATCTCATTAATCTCAAGTTATTGAATCTAAGTGGATGCTCAAGCTTAGTGGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCAAGAAATTGGATCTAAGTGGATGCTCAAGCTTAGTGGAGCTTCCTTTATCTATTGGGAATCTCATTAATCTCCAGGAACTGTATCTTAGTGAATGCTCAAGCCTAGTAGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCAAGACATTGAATCTAAGTGAATGCTCAAGCCTAGTAGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCCAGGAACTGTATCTTAGTGAATGCTCAAGCCTAGTAGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCAAGAAATTGGATCTAAGTGGATGCTCAAGCTTAGTGGAGCTTCCTTTATCTATTGGAAATCTCATTAATCTCAAGACATTGAATCTAAGTGAATGCTCAAGCCTAGTAGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCCAGGAACTGTATCTTAGTGAATGCTCAAGCCTAGTAGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCAAGAAATTGGATCTAAGTGGATGCTCAAGCTTAGTGGAGCTTCCTTTATCTATTGGAAATCTCATTAATCTCAAGACATTGAATCTAAGTGGATGCTCAAGCTTAGTGGAGCTTCCTTCATCTATTGGGAATCTCAATCTCAAGAAATTGGATCTAAGTGGATGCTCAAGCTTAGTGGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCAAGAAATTGGATCTAAGTGGATGCTCAAGCTTAGTGGAGCTTCCTTTATCTATTGGGAATCTCATTAATCTCCAGGAACTGTATCTTAGTGAATGCTCAAGCCTAGTAGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCCAGGAACTGTATCTTAGTGAATGCTCAAGCCTAGTAGAGCTTCCTTCATCTATTGGGAATCTCATTAATCTCAAGAAATTGGATCTCAACAAATGCACGAAGCTGGTATCACTCCCGCAGCTTCCAGATTCCTTATCAGTTTTAGTTGCAGAATCATGTGAGTCCTTGGAGACACTTGCTTGCTCCTTTCCGAATCCCCAAGTTTGGCTCAAATTTATTGACTGCTGGAAACTGAATGAAAAAGGGAGAGATATCATCGTCCAGACATCGACAAGTAACTACACGATGTTACCAGGTAGAGAAGTGCCTGCGTTTTTCACTTACCGAGCTACCACTGGAGGTTCTCTGGCAGTGAAGTTGAATGAGAGGCATTGTCGTACATCTTGTAGATTTAAAGCTTGCATCTTGCTGGTTAGAAAGGGTGACAAAATTGACTGTGAGGAATGGGGGTCCGTATATCTTACCGTCCTAGAGAAACAGAGTGGTCGCAAGTATAGTTTAGAAAGCCCAACTCTATATCCACTTTTAACTGAGCATCTGTACACATTCGAAATCGAAGCAAAAGGTGTGAAATCCGTAGAGCTTGTCATTAAGTTCCAATTCGGCAGGAAAAAATGGGAGATAGGTGAATGCGGGATACGCCCACTCTTGGAGGAGGACACTCACGTCGAAAGTTCTATATAA


Protein sequences

Name Description Sequence
leucine-rich repeat family protein leucine-rich repeat family protein [Arabidopsis thaliana].

MDLRYSSHLKELPNLSTAINLLEMVLSDCSSLIELPSSIGNATNIKSLDIQGCSSLLKLPSSIGNLITLPRLDLMGCSSLVELPSSIGNLINLPRLDLMGCSSLVELPSSIGNLINLEAFYFHGCSSLLELPSSIGNLISLKILYLKRISSLVEIPSSIGNLINLKLLNLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSGCSSLVELPSSIGNLNLKKLDLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLNKCTKLVSLPQLPDSLSVLVAESCESLETLACSFPNPQVWLKFIDCWKLNEKGRDIIVQTSTSNYTMLPGREVPAFFTYRATTGGSLAVKLNERHCRTSCRFKACILLVRKGDKIDCEEWGSVYLTVLEKQSGRKYSLESPTLYPLLTEHLYTFEIEAKGVKSVELVIKFQFGRKKWEIGECGIRPLLEEDTHVESSI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-595 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDLRYSSHLKELPNLSTAINLLEMVLSDCSSLIELPSSIGNATNIKSLDIQGCSSLLKLPSSIGNLITLPRLDLMGCSSLVELPSSIGNLINLPRLDLMGCSSLVELPSSIGNLINLEAFYFHGCSSLLELPSSIGNLISLKILYLKRISSLVEIPSSIGNLINLKLLNLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSGCSSLVELPSSIGNLNLKKLDLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLNKCTKLVSLPQLPDSLSVLVAESCESLETLACSFPNPQVWLKFIDCWKLNEKGRDIIVQTSTSNYTMLPGREVPAFFTYRATTGGSLAVK

HMMPanther: PTHR23155:SF304
1-595 PTHR23155:SF304

MDLRYSSHLKELPNLSTAINLLEMVLSDCSSLIELPSSIGNATNIKSLDIQGCSSLLKLPSSIGNLITLPRLDLMGCSSLVELPSSIGNLINLPRLDLMGCSSLVELPSSIGNLINLEAFYFHGCSSLLELPSSIGNLISLKILYLKRISSLVEIPSSIGNLINLKLLNLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSGCSSLVELPSSIGNLNLKKLDLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLNKCTKLVSLPQLPDSLSVLVAESCESLETLACSFPNPQVWLKFIDCWKLNEKGRDIIVQTSTSNYTMLPGREVPAFFTYRATTGGSLAVK

Gene3D: G3DSA:3.80.10.10
6-214 G3DSA:3.80.10.10

SSHLKELPNLSTAINLLEMVLSDCSSLIELPSSIGNATNIKSLDIQGCSSLLKLPSSIGNLITLPRLDLMGCSSLVELPSSIGNLINLPRLDLMGCSSLVELPSSIGNLINLEAFYFHGCSSLLELPSSIGNLISLKILYLKRISSLVEIPSSIGNLINLKLLNLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQ

superfamily: SSF52058
15-272 SSF52058,LRR

LSTAINLLEMVLSDCSSLIELPSSIGNATNIKSLDIQGCSSLLKLPSSIGNLITLPRLDLMGCSSLVELPSSIGNLINLPRLDLMGCSSLVELPSSIGNLINLEAFYFHGCSSLLELPSSIGNLISLKILYLKRISSLVEIPSSIGNLINLKLLNLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSL

HMMPfam: PF00560
IPR001611
164-186 LRR_1
Leucine-rich repeat

NLKLLNLSGCSSLVELPSSIGNL

HMMPfam: PF00560
IPR001611
188-210 LRR_1
Leucine-rich repeat

NLKKLDLSGCSSLVELPLSIGNL

HMMPfam: PF00560
IPR001611
212-234 LRR_1
Leucine-rich repeat

NLQELYLSECSSLVELPSSIGNL

Gene3D: G3DSA:3.80.10.10
215-391 G3DSA:3.80.10.10

ELYLSECSSLVELPSSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSGCSS

HMMPfam: PF00560
IPR001611
236-258 LRR_1
Leucine-rich repeat

NLKTLNLSECSSLVELPSSIGNL

superfamily: SSF52047
250-550 SSF52047,LRR

ELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLKTLNLSGCSSLVELPSSIGNLNLKKLDLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLNKCTKLVSLPQLPDSLSVLVAESCESLETLACSFPNPQVWLKFID

HMMPfam: PF12799
260-293 LRR_4,Leucine Rich repeats (2 copies)

NLQELYLSECSSLVELPSSIGNLINLKKLDLSGC

HMMPfam: PF00560
IPR001611
308-330 LRR_1
Leucine-rich repeat

NLKTLNLSECSSLVELPSSIGNL

HMMPfam: PF12799
332-365 LRR_4,Leucine Rich repeats (2 copies)

NLQELYLSECSSLVELPSSIGNLINLKKLDLSGC

HMMPfam: PF00560
IPR001611
380-402 LRR_1
Leucine-rich repeat

NLKTLNLSGCSSLVELPSSIGNL

HMMPfam: PF12799
403-436 LRR_4,Leucine Rich repeats (2 copies)

NLKKLDLSGCSSLVELPSSIGNLINLKKLDLSGC

Gene3D: G3DSA:3.80.10.10
403-535 G3DSA:3.80.10.10

NLKKLDLSGCSSLVELPSSIGNLINLKKLDLSGCSSLVELPLSIGNLINLQELYLSECSSLVELPSSIGNLINLQELYLSECSSLVELPSSIGNLINLKKLDLNKCTKLVSLPQLPDSLSVLVAESCESLETL

HMMPfam: PF00560
IPR001611
451-473 LRR_1
Leucine-rich repeat

NLQELYLSECSSLVELPSSIGNL

HMMPfam: PF00560
IPR001611
475-497 LRR_1
Leucine-rich repeat

NLQELYLSECSSLVELPSSIGNL

HMMPfam: PF13504
499-515 LRR_7,Leucine rich repeat

NLKKLDLNKCTKLVSLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox