PRGDB00049824 (disease resistance protein-related / LRR protein-related)

From PRG Wiki
Jump to: navigation, search
disease resistance protein-related / LRR protein-related
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30692895 (NM_103082)
Gene Class RLP
Domain Type LRR, LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein-related / LRR protein-related (AT1G33590) mRNA, complete cds.

DNA Sequence

ATGAACTCTTCCTTTACTCTCTTCATCTTTACCTTCGTCATCTTCCTCCAATGTCTAAATCCCACCGGAGCTGCCACGTGTCATCCTGATGATGAAGCGGGTCTTCTAGCTTTCAAAGCGGGTATAACCCGAGATCCTTCGGGTATTCTCAGTTCTTGGAAGAAAGGTACCGCTTGTTGTTCTTGGAACGGTGTCACTTGTCTCACCACTGACCGTGTCTCTGCACTCTCTGTCGCTGGACAAGCCGATGTTGCTGGAAGCTTCCTCTCCGGCACTCTCTCGCCGTCGTTGGCTAAACTCAAGCACCTTGATGGGATTTACTTCACCGATCTCAAGAACATCACTGGTTCTTTTCCTCAATTCCTTTTCCAATTACCAAATCTTAAGTACGTATACATTGAGAATAACCGTCTCTCTGGTACTCTTCCGGCTAACATCGGTGCGCTAAGCCAGCTTGAAGCGTTCAGCCTCGAGGGAAACCGGTTCACCGGTCCGATCCCGAGCTCGATATCTAATTTGACTCTGTTAACTCAACTCAAACTCGGCAATAATCTCCTAACCGGAACTATACCGTTAGGGGTCGCTAATCTCAAGCTCATGTCGTATCTCAACCTTGGAGGTAACCGTCTCACTGGAACCATTCCAGATATTTTCAAATCCATGCCAGAGCTCCGATCTTTAACTCTCTCCCGCAACGGATTCTCCGGGAATCTTCCTCCGTCCATTGCATCACTCGCACCGATTCTTAGGTTCCTCGAGTTAGGCCATAACAAACTCTCCGGGACGATTCCAAACTTTTTATCAAACTTCAAGGCGCTCGACACATTGGATCTCTCCAAGAATCGGTTCTCGGGTGTCATACCGAAGAGTTTCGCCAATCTGACCAAGATATTCAATCTTGATCTCTCCCATAATCTTCTAACCGATCCATTCCCTGTCTTGAACGTTAAAGGCATTGAATCTTTGGATCTTTCTTACAACCAGTTTCACTTGAATACGATCCCGAAATGGGTGACTTCGTCGCCGATCATCTTCTCGTTGAAGCTAGCAAAATGCGGGATCAAGATGAGCTTAGACGATTGGAAGCCAGCGCAAACATTCTACTATGATTTCATCGATCTGTCGGAAAACGAGATCACAGGGAGTCCAGCAAGGTTCTTGAACCAAACAGAGTATCTAGTGGAGTTCAAGGCAGCGGGTAACAAACTACGATTCGATATGGGGAAGCTAACGTTTGCAAAGACGCTGACAACTTTAGATATATCAAGGAACTTGGTATTTGGGAAGGTGCCGGCAATGGTGGCTGGACTAAAGACATTGAACGTGAGTCACAACCATCTTTGTGGAAAGCTTCCAGTAACAAAGTTCCCGGCCAGTGCGTTTGTGGGTAATGACTGTCTTTGCGGCTCTCCTCTTTCTCCTTGTAAAGCTTAA


Protein sequences

Name Description Sequence
disease resistance protein-related / LRR protein-related disease resistance protein-related / LRR protein-related [Arabidopsis thaliana].

MNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCKA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF510
1-474 PTHR24420:SF510

MNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

HMMPanther: PTHR24420
1-474 PTHR24420,FAMILY NOT NAMED

MNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

superfamily: SSF52058
25-364 SSF52058,LRR

ATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPA

Gene3D: G3DSA:3.80.10.10
26-245 G3DSA:3.80.10.10

TCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGTLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTLLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASL

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTC

HMMPfam: PF00560
IPR001611
127-149 LRR_1
Leucine-rich repeat

NLKYVYIENNRLSGTLPANIGAL

HMMPfam: PF13855
176-232 LRR_8,Leucine rich repeat

LTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRN

HMMPfam: PF13855
249-307 LRR_8,Leucine rich repeat

LRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLL

Gene3D: G3DSA:3.80.10.10
249-474 G3DSA:3.80.10.10

LRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

superfamily: SSF52058
315-452 SSF52058,LRR

NVKGIESLDLSYNQFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLP

HMMPfam: PF00560
IPR001611
437-456 LRR_1
Leucine-rich repeat

LKTLNVSHNHLCGKLPVTKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox