PRGDB00049827 (hypothetical protein)

From PRG Wiki
Jump to: navigation, search
hypothetical protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18422681 (NM_124020)
Gene Class Unknown
Domain Type LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana unknown protein (AT5G46500) mRNA, complete cds.

DNA Sequence

ATGATGTTGTCTCCCACTTTGACGAGCCATTGCAGCAGGCTAAAATGTGTATCCCTACACATTTCTAAACTGAAACATCTTGAGGACGCTTTGTTTCCAGCTTGTGGGGCATTAAATCGAGTTGAATTGAGTGGTTCTTCTAGTGGGATGAAAGCAGACAATATTGACACAGCCTCCTCTTCTCTTCCTCAAGTCGAACTTGATTTCAGGGAGTGCTTCAACTTGGATCCAGAAACTGTCCTTCACCAAGAATCAATTATATTCAAGTACATGTTATTTCCAGGGAAAGAAGAAGTGCCATCATATTTCACTTACCGTACTACTGGAGTCTCCTCTCTGACCATTCCTCTACTTCACCTCCCTCTCTCCCAACCATTCTTCAGATTTAGGGTTGGCGCATTGGTAACTAATGTTAAGCATGGAAAAAATATAAAGGTAAAATGTGAGTTCAAAGACAGATTTGGGAACAGCTTTCATGTTGGCTCGGATGATTTCTACGTTTATCTACTTTTCACGAAAAGTCAGAAGGGTAGTCAAATGTTAACTATATTGGACTGTTGTATCCCTCTAAACGAAGGTAATGCTTCTCTAGCTCAAGGGAACTACTACGATCATGTGGATATAAATATTCATATAACAGAATCTCTTGGATCTTTTGGATCTACGTCTGAATTAAAAGAATGGGGTATACGACTCTTAGAGGAAGACTCTTCATCAGCAGAGAACCAACTTGGTAATCCGAACAGTACTCTTCCACATGTTTCTGAAGCCGAAGAAGGCAATATGGGGTATTATACACCTGTTCAAGGACTTGTTAATGAGATTGAACACAATGGAGAGTCTGGAGATAACAATGTAGAGACTGAGAGAAGCACGAAGCATGCGGCTCAACGGAACTACTACGATCATGTGGATATAGATATTGAGCAAATGGATAGTGATGATGATATTGAAGAATGGGGTAGACACTTAGAGGACTGTCATCAGCGAAGAATCGACATGGTAATCCAAACACTATGCAGTATGTTTGTGAAGCCGATGAAGACAATGATGGATGCCATTAGACTGATCACAACGAAGAGCGAGGAGACAGTGATGAATAGTGATATAGGCAGGGAGACTGATCACTTTGAAGAGTGCGAAGATAGTGATATAAGCAATGAGAGTGATCAGAGTGAAGAGCGTGGGGATAGTGACGATGATGGTATAAACAATGAGACTGATCTGTTCGAAGAGTGTGGAAACAGTGATTAG


Protein sequences

Name Description Sequence
hypothetical protein unknown protein [Arabidopsis thaliana].

MMLSPTLTSHCSRLKCVSLHISKLKHLEDALFPACGALNRVELSGSSSGMKADNIDTASSSLPQVELDFRECFNLDPETVLHQESIIFKYMLFPGKEEVPSYFTYRTTGVSSLTIPLLHLPLSQPFFRFRVGALVTNVKHGKNIKVKCEFKDRFGNSFHVGSDDFYVYLLFTKSQKGSQMLTILDCCIPLNEGNASLAQGNYYDHVDINIHITESLGSFGSTSELKEWGIRLLEEDSSSAENQLGNPNSTLPHVSEAEEGNMGYYTPVQGLVNEIEHNGESGDNNVETERSTKHAAQRNYYDHVDIDIEQMDSDDDIEEWGRHLEDCHQRRIDMVIQTLCSMFVKPMKTMMDAIRLITTKSEETVMNSDIGRETDHFEECEDSDISNESDQSEERGDSDDDGINNETDLFEECGNSD

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
11-264 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

CSRLKCVSLHISKLKHLEDALFPACGALNRVELSGSSSGMKADNIDTASSSLPQVELDFRECFNLDPETVLHQESIIFKYMLFPGKEEVPSYFTYRTTGVSSLTIPLLHLPLSQPFFRFRVGALVTNVKHGKNIKVKCEFKDRFGNSFHVGSDDFYVYLLFTKSQKGSQMLTILDCCIPLNEGNASLAQGNYYDHVDINIHITESLGSFGSTSELKEWGIRLLEEDSSSAENQLGNPNSTLPHVSEAEEGNMGY

HMMPanther: PTHR11017:SF20
11-264 PTHR11017:SF20,SUBFAMILY NOT NAMED

CSRLKCVSLHISKLKHLEDALFPACGALNRVELSGSSSGMKADNIDTASSSLPQVELDFRECFNLDPETVLHQESIIFKYMLFPGKEEVPSYFTYRTTGVSSLTIPLLHLPLSQPFFRFRVGALVTNVKHGKNIKVKCEFKDRFGNSFHVGSDDFYVYLLFTKSQKGSQMLTILDCCIPLNEGNASLAQGNYYDHVDINIHITESLGSFGSTSELKEWGIRLLEEDSSSAENQLGNPNSTLPHVSEAEEGNMGY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox