PRGDB00049828 (nucleoside-triphosphatase/ nucleotide binding / transmembrane receptor)

From PRG Wiki
Jump to: navigation, search
nucleoside-triphosphatase/ nucleotide binding / transmembrane receptor
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 145343631 (NM_118473)
Gene Class N
Domain Type TIR, LRR, NBS
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana nucleoside-triphosphatase/ nucleotide binding / transmembrane receptor (AT4G23440) mRNA, complete cds.

DNA Sequence

ATGGATTCTCGAGGTGACAGTTCTAGGTTCGGGCAATATCCGACAAAGCCTACAAGGAACATGTCTTCATCTTCATCAGCTGCTTTCTTCTCAGCTAATCAGTCTCCGTTTTTCTCACCAAGATCTCCTAAAATCCAACAAGAACTATCTGAATCTACTCGCTCTGATGCTCAATGTGATAGCTTTGATCCTCTTAGCTCCAGCTCTGGTTTTCAAGAGCCTGAGCTTGCGTTTTTAACCGCTCCTAATCAATGTCAGAGCCTTGAGGCTGCTGATCGAATCGCTTCGAGTAGTATGATCTCTTGTACTCCTTCTAGATATGGAAGAGGTCATGAGTCTTCTTCGTATACTCAGACATCTTCTGTATCTGTTTCTTATAATAGGTTGAGATGTTGTGATGTGTTTATAGGATTGTATGGTCAGAAGCCTTCTTTGCTTCGGTTTGCGGATTGGCTTAGAGCTGAGTTAGAGTTTCAAGGGATGAGTTGTTTTATGTCGGATAGAGGAAGATGTAGGAGTTCACGGAAACAGAGAATAGTTGAGAGAGCGATGGATGGTGCGTCGTTTGGAGTTATAATACTAACGAGAAAGGCGTTTAAGAATCCTTATACGATTGAGGAGCTACGGTTTTTCGCAAACAAGAAGAATCTTGTTCCGGTTTTCTTTGATCTTTCTCCTGGAGAGTGTCTTGTGAGAGATATAGTTGAGAAGAGAGGAGATTTGTGGGAGAAACATGGAGGGGAATTGTGGGTTTTGTATGGTGGGATTGAGAAAGAATGGAAAGAGGCGGTTCACGGGCTATCGCGGGTTGATGATTGGAAGCTTGAAGCTCATGAAGGTAACTGGAGAGATTGTGTTTTCAGGGCGGTTACTTTATTGGCAATGCGGTTAGGGAGGAGAAGTATAGTGGAACGGTTAACGAAATGGCGGGATAAAGCGGAGAAAGAGGAGTTTCCGTATCCGCGGAATGAGAGTTTTGTTGGGAGGAAGAAGGAGTTATCTGAGCTAGAGTTTGTTTTATTTGGAGATGTTGCTGGAGATTCTGAAAGGGATTACTTTGAGTTAAAGGCAAGGCCGACAAGAAGGAAGAAGAACGTGACGCTCGGGTGGAATAAAAGCGGTTCAGCGGAAGAAAGACGGAAGAAAGGGAAGGAAAAAGTTGTGTGGAAGGAGTCAGAGAAAGAGATTGAGATGCAAAGTACAGAGATGCCTTCACGGAGTCAAGTGAAAGTAGGGCGAAACACGAGGAGAAAACGGTCGATGAAGGTTGTTTACGGGAAAGGCGTGGCTTGCGTGTCAGGTGAATCAGGGATTGGAAAAACTGAGCTGCTTCTTGAATTTGCTTACAGGCATCACCAAAGGTATAAGATGGTTCTTTGGATAGGTGGTGAGAGCCGTTACATAAGACAGAACTATCTGAATCTTTATCAGTATTTGGAAGTCGACATCGGGATAGAGAATTCTTCGGATAAAACGCGGATGAAGAGCTTCGAAGAGCAAGAAGATGCTGCGGTTTCCAAGATTAGAAAAGAGCTGATGAGGAATATACCGTTCTTGGTTGTCATTGATAACTTGGAGAGTGAAAAAGACTGGTGGGATTCGAAGCTTGTGATGGATCTTCTTCCTCGGTTTGGAGGCGGGACTCATATTTTGATATCTACACGTCTCTCTCAAGTTATGAACATGGAGCCGTTGAAACTCTCTTACCTCTCTGGTGCTGAAGCTATGTCGTTGATGCAGGGGAATGTTAAAGATTATCCGGTTTCGGAAATGGATGCATTGAGAACTATTGAAGATAAACTCGGACGGTTAACGTTGGGATTAGCAGTCGTAGGAGCAATATTGTCAGAGCTTCCTATAAACCCGAGCCGGCTTTTGGATACTATAAATAGAATGCCGTTAAGAGAGATGGTGTGTAGTGGTCGAGAGGGGAATCTGTTGAGAAGAAATGCGTTTCTGTTGCAGCTGTTTGAAGTTTGTTTTTCGATCTTTGATCACGCGGATGGACCTAGAAGTTTGGCTACGAGAATGGTTGTTGCTAGTGGGTGGTTAGCTCCTGCACCAGTTCCAGCTTCTTTATTAGCTTTGGCTGCTCATAAACTCCCTGAGAAACACAGAGGTCCGAAGCGGCTATGGAGAAGACTAAGGCGCGCTATAACCTGCGGTTTTACGTCTTCAAACTCCAAACGATCAGGAGCTGAAGCTGCTTCAATGCTACTTAGATTCAACATTGCTCGAACCAGCAGCATCAAGCTAGGGTTTATACAGATCCACGAGCTTGTGAAACTCTATGCGAGAAATCGAGTACTGGTCAATGAAAACGCTCCCGCAATGGTTCAGGCGGTGATAAGCCGCGGCTCGACTGTTGAAACCGCAGAGCAGATCTGGGCGGTTTGTTTCTTGCTGTTTGGTTTTAGCAACGAATCTCCGACTATTCAGCTGAAGATAACAGAGCTGCTGATTCTTGTGAAACAAGTAATCTTGCCTCTTGCAATCAGAACGTTCATATCATTTTCGCGATGCACAGCCTCAGTGGAGCTACTAAGGGTCTGCACAAACGCACTTGAAGCAGCTGACCAAACGCTAGTGACACCAGTAGAGAAATGGCTAGACAAGTCGCTTTGCTGGAGACCAGTTCAGACAAGTGCACAACTAAACCCTATTCTATGGGAAGAACTTGCTCTAGCTCGAGCCACCGTGCTAGAGACTCGAGCTAAGCTGATGTTACGAGGCGGGCAATTTGGTTTGGCTGATGACTTGATCAGAAAAGCAATCTTCATAAGAACTTCGATCTCAGGAGAGGATCATCCTGGGACTGTGTCGGCTCGAGAGACATTGAGTAAGTTAACGAGGCTTTTATCCAATGTTCATCAGATTCATAACACTTCACCGTAA


Protein sequences

Name Description Sequence
nucleoside-triphosphatase/ nucleotide binding / transmembrane receptor nucleoside-triphosphatase/ nucleotide binding / transmembrane receptor [Arabidopsis thaliana].

MDSRGDSSRFGQYPTKPTRNMSSSSSAAFFSANQSPFFSPRSPKIQQELSESTRSDAQCDSFDPLSSSSGFQEPELAFLTAPNQCQSLEAADRIASSSMISCTPSRYGRGHESSSYTQTSSVSVSYNRLRCCDVFIGLYGQKPSLLRFADWLRAELEFQGMSCFMSDRGRCRSSRKQRIVERAMDGASFGVIILTRKAFKNPYTIEELRFFANKKNLVPVFFDLSPGECLVRDIVEKRGDLWEKHGGELWVLYGGIEKEWKEAVHGLSRVDDWKLEAHEGNWRDCVFRAVTLLAMRLGRRSIVERLTKWRDKAEKEEFPYPRNESFVGRKKELSELEFVLFGDVAGDSERDYFELKARPTRRKKNVTLGWNKSGSAEERRKKGKEKVVWKESEKEIEMQSTEMPSRSQVKVGRNTRRKRSMKVVYGKGVACVSGESGIGKTELLLEFAYRHHQRYKMVLWIGGESRYIRQNYLNLYQYLEVDIGIENSSDKTRMKSFEEQEDAAVSKIRKELMRNIPFLVVIDNLESEKDWWDSKLVMDLLPRFGGGTHILISTRLSQVMNMEPLKLSYLSGAEAMSLMQGNVKDYPVSEMDALRTIEDKLGRLTLGLAVVGAILSELPINPSRLLDTINRMPLREMVCSGREGNLLRRNAFLLQLFEVCFSIFDHADGPRSLATRMVVASGWLAPAPVPASLLALAAHKLPEKHRGPKRLWRRLRRAITCGFTSSNSKRSGAEAASMLLRFNIARTSSIKLGFIQIHELVKLYARNRVLVNENAPAMVQAVISRGSTVETAEQIWAVCFLLFGFSNESPTIQLKITELLILVKQVILPLAIRTFISFSRCTASVELLRVCTNALEAADQTLVTPVEKWLDKSLCWRPVQTSAQLNPILWEELALARATVLETRAKLMLRGGQFGLADDLIRKAIFIRTSISGEDHPGTVSARETLSKLTRLLSNVHQIHNTSP

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
120-273 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSVSVSYNRLRCCDVFIGLYGQKPSLLRFADWLRAELEFQGMSCFMSDRGRCRSSRKQRIVERAMDGASFGVIILTRKAFKNPYTIEELRFFANKKNLVPVFFDLSPGECLVRDIVEKRGDLWEKHGGELWVLYGGIEKEWKEAVHGLSRVDDW

HMMPfam: PF13676
147-223 TIR_2,TIR domain

RFADWLRAELEFQGMSCFMSDRGRCRSSRKQRIVERAMDGASFGVIILTRKAFKNPYTIEELRFFANKKNLVPVFFD

superfamily: SSF52540
393-602 SSF52540

EKEIEMQSTEMPSRSQVKVGRNTRRKRSMKVVYGKGVACVSGESGIGKTELLLEFAYRHHQRYKMVLWIGGESRYIRQNYLNLYQYLEVDIGIENSSDKTRMKSFEEQEDAAVSKIRKELMRNIPFLVVIDNLESEKDWWDSKLVMDLLPRFGGGTHILISTRLSQVMNMEPLKLSYLSGAEAMSLMQGNVKDYPVSEMDALRTIEDKLG

HMMSmart: SM00382
IPR003593
426-636 AAA,NBS
AAA+ ATPase domain

GKGVACVSGESGIGKTELLLEFAYRHHQRYKMVLWIGGESRYIRQNYLNLYQYLEVDIGIENSSDKTRMKSFEEQEDAAVSKIRKELMRNIPFLVVIDNLESEKDWWDSKLVMDLLPRFGGGTHILISTRLSQVMNMEPLKLSYLSGAEAMSLMQGNVKDYPVSEMDALRTIEDKLGRLTLGLAVVGAILSELPINPSRLLDTINRMPLRE

Gene3D: G3DSA:3.40.50.300
429-556 G3DSA:3.40.50.300

VACVSGESGIGKTELLLEFAYRHHQRYKMVLWIGGESRYIRQNYLNLYQYLEVDIGIENSSDKTRMKSFEEQEDAAVSKIRKELMRNIPFLVVIDNLESEKDWWDSKLVMDLLPRFGGGTHILISTRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox