PRGDB00049831 (Toll-Interleukin-Resistance (TIR) domain-containing protein)

From PRG Wiki
Jump to: navigation, search
Toll-Interleukin-Resistance (TIR) domain-containing protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18412470 (NM_116649)
Gene Class TNL
Domain Type TIR, LRR
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana Toll-Interleukin-Resistance (TIR) domain-containing protein (AT4G04110) mRNA, complete cds.

DNA Sequence

ATGAACGATAAACACGACACAGATTTAACATTCAAACGAATCGCAGCTCAATTTCTAACACTTTCTCTGATTCGTTTCTCAAAAAAATCTCATTCCTCGCTCCATTATGGCTTGCAATTTTGGGTACTCTATGTCTTTCCGAGCTTTAGCGTTGAAGACATCCGTCAAACATTCCTCAGCCACTTTCTCAAGGATCTTGATCGGAAGCTGATCATTGCTTTTAAAGATAACGAGATTGAGAGAAGCCAATCGCTTAATCCCGATCTTAAACGACCGATTAGAGATTCGAGAATTGCGATTGTTATCTTTTCCAAAAACTACGCTTCTTCAAGCTGGTGTTTAAATGAATTGCTGGAGATTGTTAGATGCAAAGAAGATAGCAATCGATTGGTGGTGATTCCTGTTTTCTATGGCTTGGATCCGTCTCATGTTAGGAAACAAATCGGCAATTTTGGAAAAATCTTTAAGAAGACTTGTCAAAACAGAACAGAGGATGAGATAAATCTGCGGAGGAGAGCTTTGATCGATGTAGCTAATACTCTCGGATATCATTCTACGATTTGTAAAGCAAATATGACAAAAGAAATCACCAATGATGTTTTGGTTAAACTGAATTTAACTCCATCAAATGATATTGAGGATTTTGAAGTGAGGATGGTTCGGATTTGGGGTTTTTATTTAGTCGTCTCTCTCGTCATTTCCAAGGTAGTGTCTTCATAG


Protein sequences

Name Description Sequence
Toll-Interleukin-Resistance (TIR) domain-containing protein Toll-Interleukin-Resistance (TIR) domain-containing protein [Arabidopsis thaliana].

MNDKHDTDLTFKRIAAQFLTLSLIRFSKKSHSSLHYGLQFWVLYVFPSFSVEDIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINLRRRALIDVANTLGYHSTICKANMTKEITNDVLVKLNLTPSNDIEDFEVRMVRIWGFYLVVSLVISKVVSS

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
31-183 TIR
Toll/interleukin-1 receptor homology (TIR) domain

HSSLHYGLQFWVLYVFPSFSVEDIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINLRRRALIDVANTLGY

ProfileScan: PS50104
IPR000157
41-180 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WVLYVFPSFSVEDIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINLRRRALIDVANT

HMMSmart: SM00255
IPR000157
42-180 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VLYVFPSFSVEDIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINLRRRALIDVANT

Gene3D: G3DSA:3.40.50.10140
45-174 G3DSA:3.40.50.10140

VFPSFSVEDIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINLRRRAL

HMMPfam: PF01582
IPR000157
45-169 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFPSFSVEDIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINL

HMMPanther: PTHR23155
53-224 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINLRRRALIDVANTLGYHSTICKANMTKEITNDVLVKLNLTPSNDIEDFEVRMVRIWG

HMMPanther: PTHR23155:SF297
53-224 PTHR23155:SF297

DIRQTFLSHFLKDLDRKLIIAFKDNEIERSQSLNPDLKRPIRDSRIAIVIFSKNYASSSWCLNELLEIVRCKEDSNRLVVIPVFYGLDPSHVRKQIGNFGKIFKKTCQNRTEDEINLRRRALIDVANTLGYHSTICKANMTKEITNDVLVKLNLTPSNDIEDFEVRMVRIWG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox