PRGDB00049833 (regulator of chromosome condensation (RCC1) family protein)

From PRG Wiki
Jump to: navigation, search
regulator of chromosome condensation (RCC1) family protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18403703 (NM_113228)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana regulator of chromosome condensation (RCC1) family protein (AT3G23270) mRNA, complete cds.

DNA Sequence

ATGGCAGATCCTGCTAGTTGTTATATCTATCACGAGCGTGACGTCGACCAAGCACTTGTCGTATTGAAAAAGGGAACTCAATTACTCAAGTATAGTCGGAAAGGGAAACCTAAATTCCGCGCATTCAGGCTTTCTCCGGATGAAAAAACGTTGATTTGGTTCTCGCGTGGAGAAGAAAAAGGTTTGAAGTTATTTGAAGTTTCTCGTATTGTCCCGGGACAAAGAACTAGATTTCTACGTCCAGAGAAAGATCACTTATCATTTTCACTTCTATATAACAACAGAGAAAGGTCACTTGATCTGATTTGTAAGGACAAAGCTGAGACAGAGGTGTGGTTTGCTGCCCTTAAATTTTTGATTGAAAAAAGTCGTAATCGACGCGCCAGAAGTGAAATCCCTGAGATACATGATAGTGACACTTTCTCTGTTGGTCGTCAATCTATAGACTTTGTCCCAAGCAATATTCCACGAGGTAGAACATCAATTGACTTAGGCTATCAGAACAATTCAGATGTGGGATATGAACGTGGAAACATGTTAAGACCAAGTACAGATGGTTTTCGGATCAGTGTCTCAAGCACACCAAGTTGTTCAAGTGGAGGATCTGGTCCGGATGATATTGAATCATTAGGTGATGTTTACGTTTGGGGTGAAGTTTGGACTGAAGGGATATTACCAGACGGAACTGCTAGCAATGAAACTGTGAAAACAGATGTACTAACTCCAAGACCTTTGGAATCAAATGTTGTTCTCGATGTTCACCAGATTGTTTGCGGTGTAAGGCACGTTGCGCTTGTGACAAGACAAGGAGAGGTTTTTACTTGGGGAGAAGAAGTTGGAGGAAGGCTTGGACATGGTATACAAGTAGATATTAGTCGTCCAAAACTCGTTGAGTTTCTTGCTCTAACCAACATAGACTTTGTTGCATGTGGAGAATATCATACTTGTGTTGTATCTACCTCTGGTGACTTGTTTTCATGGGGAGATGGAATCCATAATGTTGGGCTATTAGGACATGGTAGTGATATAAGCCATTGGATACCTAAAAGAGTCTCTGGTCCTTTAGAAGGTCTTCAAGTACTCTCAGTTGCTTGTGGAACATGGCATTCAGCTTTAGCTACTGCGAACGGGAAGCTATTCACGTTTGGTGATGGAGCGTTTGGCGTTTTAGGTCATGGAAACAGAGAAAGTGTTTCATATCCTAAGGAAGTACAATCATTAAACGGTTTGAAAACGGTGAAAGTAGCTTGTAGTATTTGGCATACCGCAGCGATTGTCGAGGTTATGGGTCAAACCGCTACGAGTATGTCATCTAGGAAGTTGTTTACTTGGGGTGATGGTGACAAAAACAGGTTGGGACACGGAAACAAAGAGACTTACTTGCTTCCAACTTGTGTATCTTCTCTTATTGACTACAACTTTCATAAGATTGCTTGTGGGCATACATTTACCGTCGCACTCACAACTTCTGGACATGTTTTTACTATGGGTGGTACCGCTCATGGTCAGCTAGGTAACTCAATCTCTGATGGTAAATTACCATGCTTGGTTCAAGATAGATTAGTCGGAGAATTCGTGGAAGAAATCGCGTGCGGAGCTCACCATGTCGCGGTTTTGACATCTAGAAGTGAAGTCTTCACGTGGGGAAAAGGTGCTAATGGAAGATTAGGACATGGAGATACAGAGGATAAAAGAACACCAACTTTGGTTGAAGCCTTGAGAGATAGGCATGTGAAGAGTTTATCTTGCGGCTCAAACTTTACGTCAAGTATATGTATACATAAGTGGGTATCCGGAGCAGATCAGTCAATCTGCTCCGGATGTCGTCAAGCATTCGGATTTACCCGGAAGAGGCATAACTGTTATAACTGTGGTTTAGTCCATTGTCATGCTTGTAGCTCAAAGAAAGCTTTAAAAGCAGCTTTAGCTCCAACTCCGGGGAAACCACATCGCGTATGTGATGCTTGTTACAGCAAACTTAAAGCCGCGGAGTCTGGTTATAGTTCTAATGTAAACAGGAATGTTGCAACTCCAGGACGGTCAATAGATGGATCAGTAAGAACTGATAGAGAAACAACAAGGTCATCGAAAGTTCTCTTGTCCGCAAATAAAAATTCAGTCATGTCATCATCAAGGCCTGGATTCACACCTGAGTCTTCTAATGCTCGTGCCTCGCAAGTTCCATCTCTCCAACAACTTAAAGACATTGCATTCCCAAGTTCGCTTAGCGCCATTCAAAATGCTTTCAAACCTGTTGTTGCTCCAACTACTACTCCACCACGTACACTTGTTATTGGACCATCATCTCCATCACCGCCTCCACCTCCAAGATCATCCTCTCCTTATGCAAGAAGACCGAGCCCTCCACGCACTTCTGGATTTTCAAGAAGTGTTATCGATAGTTTAAGGAAGACTAACGAAGTTATGAACCAAGAAATGACAAAACTGCATAGTCAGCAGAGATGTAATAATCAAGGTACAGAGATTGAAAGATTTCAAAAAGCAGCTAAAGACGCTTCTGAATTAGCTGCAAGACAATCTTCAAAACATAAAGCAGCAACAGAAGCACTCAAGTCTGTTGCAGAACAGTTAAAAGAATTGAAGGAGAAATTACCTCCAGAAGTATCAGAGAGTGAAGCATTTGAATCCATTAACTCTCAAGCTGAAGCTTATCTAAACGCAAACAAAGTATCAGAAACATCTCCACTTACAACTTCGGGACAAGAACAAGAAACATATCAAAAGACAGAGGAACAAGTACCTTCTAACTCAAGTATAACCGAGACATCGAGTTCATCAAGGGCACCAAGTACAGAAGCTTCATCATCAAGAATAAGTGGAAAAGAAAGTAAAGAACAATTTGAGCCTGGTGTTTATGTGACTTATGAGGTAGACATGAATGGTAACAAGATCTTTCGACGAGTTAGATTTAGTAAAAAAAGATTTGATGAGCATCAAGCAGAAGATTGGTGGACCAAAAACAAAGATAGGTTGCTTAAGTGTTATAGTTCAAATTCATCATCATCATCATCATCATCGAATCCAACGGCTTCCGACTCACCTGTTGCTCCACAACCACCGTCTGATCCGTCGGTACCTGAACAGAGCAATGAGAAGGAACCAGATTCTGAAACCTAG


Protein sequences

Name Description Sequence
regulator of chromosome condensation (RCC1) family protein regulator of chromosome condensation (RCC1) family protein [Arabidopsis thaliana].

MADPASCYIYHERDVDQALVVLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIEKSRNRRARSEIPEIHDSDTFSVGRQSIDFVPSNIPRGRTSIDLGYQNNSDVGYERGNMLRPSTDGFRISVSSTPSCSSGGSGPDDIESLGDVYVWGEVWTEGILPDGTASNETVKTDVLTPRPLESNVVLDVHQIVCGVRHVALVTRQGEVFTWGEEVGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVVSTSGDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIWHTAAIVEVMGQTATSMSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACGHTFTVALTTSGHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVLTSRSEVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFTSSICIHKWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLKAAESGYSSNVNRNVATPGRSIDGSVRTDRETTRSSKVLLSANKNSVMSSSRPGFTPESSNARASQVPSLQQLKDIAFPSSLSAIQNAFKPVVAPTTTPPRTLVIGPSSPSPPPPPRSSSPYARRPSPPRTSGFSRSVIDSLRKTNEVMNQEMTKLHSQQRCNNQGTEIERFQKAAKDASELAARQSSKHKAATEALKSVAEQLKELKEKLPPEVSESEAFESINSQAEAYLNANKVSETSPLTTSGQEQETYQKTEEQVPSNSSITETSSSSRAPSTEASSSRISGKESKEQFEPGVYVTYEVDMNGNKIFRRVRFSKKRFDEHQAEDWWTKNKDRLLKCYSSNSSSSSSSSNPTASDSPVAPQPPSDPSVPEQSNEKEPDSET

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:2.30.29.30
IPR011993
12-127 PH_type
Pleckstrin homology-like domain

ERDVDQALVVLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIEKSRNRR

superfamily: SSF50729
12-121 SSF50729

ERDVDQALVVLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIE

HMMPfam: PF12814
IPR024774
15-121 Mcp5_PH
Pleckstrin homology domain, Mcp5-type

VDQALVVLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIE

ProfileScan: PS50003
IPR001849
20-121 PH_DOMAIN
Pleckstrin homology domain

VVLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIE

HMMSmart: SM00233
IPR001849
21-123 PH
Pleckstrin homology domain

VLKKGTQLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIEKS

HMMPanther: PTHR22870
27-712 PTHR22870,REGULATOR OF CHROMOSOME CONDENSATION

QLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIEKSRNRRARSEIPEIHDSDTFSVGRQSIDFVPSNIPRGRTSIDLGYQNNSDVGYERGNMLRPSTDGFRISVSSTPSCSSGGSGPDDIESLGDVYVWGEVWTEGILPDGTASNETVKTDVLTPRPLESNVVLDVHQIVCGVRHVALVTRQGEVFTWGEEVGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVVSTSGDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIWHTAAIVEVMGQTATSMSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACGHTFTVALTTSGHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVLTSRSEVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFTSSICIHKWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLKAAESGYSSNVNRNVATPGRSIDGSVRTDRETTRSSKVLLSANKNSVMSSSR

HMMPanther: PTHR22870:SF25
27-712 PTHR22870:SF25,REGULATOR OF CHROMOSOME CONDENSATION-RELATED

QLLKYSRKGKPKFRAFRLSPDEKTLIWFSRGEEKGLKLFEVSRIVPGQRTRFLRPEKDHLSFSLLYNNRERSLDLICKDKAETEVWFAALKFLIEKSRNRRARSEIPEIHDSDTFSVGRQSIDFVPSNIPRGRTSIDLGYQNNSDVGYERGNMLRPSTDGFRISVSSTPSCSSGGSGPDDIESLGDVYVWGEVWTEGILPDGTASNETVKTDVLTPRPLESNVVLDVHQIVCGVRHVALVTRQGEVFTWGEEVGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVVSTSGDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIWHTAAIVEVMGQTATSMSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACGHTFTVALTTSGHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVLTSRSEVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFTSSICIHKWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLKAAESGYSSNVNRNVATPGRSIDGSVRTDRETTRSSKVLLSANKNSVMSSSR

Gene3D: G3DSA:2.130.10.30
IPR009091
209-594 Reg_csome_cond/b-lactamase_inh
Regulator of chromosome condensation/beta-lactamas

SLGDVYVWGEVWTEGILPDGTASNETVKTDVLTPRPLESNVVLDVHQIVCGVRHVALVTRQGEVFTWGEEVGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVVSTSGDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIWHTAAIVEVMGQTATSMSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACGHTFTVALTTSGHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVLTSRSEVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFTSSICIH

superfamily: SSF50985
IPR009091
211-598 RCC1/BLIP-II
Regulator of chromosome condensation/beta-lactamas

GDVYVWGEVWTEGILPDGTASNETVKTDVLTPRPLESNVVLDVHQIVCGVRHVALVTRQGEVFTWGEEVGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVVSTSGDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSALATANGKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIWHTAAIVEVMGQTATSMSSRKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACGHTFTVALTTSGHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVLTSRSEVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFTSSICIHKWVS

ProfileScan: PS50012
IPR000408
211-269 RCC1_3
Regulator of chromosome condensation, RCC1

GDVYVWGEVWTEGILPDGTASNETVKTDVLTPRPLESNVVLDVHQIVCGVRHVALVTRQ

HMMPfam: PF00415
IPR000408
270-318 RCC1
Regulator of chromosome condensation, RCC1

GEVFTWGEEVGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVV

ProfileScan: PS50012
IPR000408
270-321 RCC1_3
Regulator of chromosome condensation, RCC1

GEVFTWGEEVGGRLGHGIQVDISRPKLVEFLALTNIDFVACGEYHTCVVSTS

FPrintScan: PR00633
IPR000408
272-288 RCCNDNSATION
Regulator of chromosome condensation, RCC1

VFTWGEEVGGRLGHGIQ

HMMPfam: PF00415
IPR000408
321-372 RCC1
Regulator of chromosome condensation, RCC1

SGDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSAL

ProfileScan: PS50012
IPR000408
322-376 RCC1_3
Regulator of chromosome condensation, RCC1

GDLFSWGDGIHNVGLLGHGSDISHWIPKRVSGPLEGLQVLSVACGTWHSALATAN

FPrintScan: PR00633
IPR000408
322-338 RCCNDNSATION
Regulator of chromosome condensation, RCC1

GDLFSWGDGIHNVGLLG

FPrintScan: PR00633
IPR000408
363-379 RCCNDNSATION
Regulator of chromosome condensation, RCC1

VACGTWHSALATANGKL

HMMPfam: PF00415
IPR000408
376-425 RCC1
Regulator of chromosome condensation, RCC1

NGKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIWHTAAI

ProfileScan: PS50012
IPR000408
377-428 RCC1_3
Regulator of chromosome condensation, RCC1

GKLFTFGDGAFGVLGHGNRESVSYPKEVQSLNGLKTVKVACSIWHTAAIVEV

FPrintScan: PR00633
IPR000408
379-393 RCCNDNSATION
Regulator of chromosome condensation, RCC1

LFTFGDGAFGVLGHG

ProfileScan: PS50012
IPR000408
439-490 RCC1_3
Regulator of chromosome condensation, RCC1

RKLFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACGHTFTVALTTS

HMMPfam: PF00415
IPR000408
441-487 RCC1
Regulator of chromosome condensation, RCC1

LFTWGDGDKNRLGHGNKETYLLPTCVSSLIDYNFHKIACGHTFTVAL

FPrintScan: PR00633
IPR000408
480-498 RCCNDNSATION
Regulator of chromosome condensation, RCC1

GHTFTVALTTSGHVFTMGG

HMMPfam: PF00415
IPR000408
490-539 RCC1
Regulator of chromosome condensation, RCC1

SGHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVL

ProfileScan: PS50012
IPR000408
491-542 RCC1_3
Regulator of chromosome condensation, RCC1

GHVFTMGGTAHGQLGNSISDGKLPCLVQDRLVGEFVEEIACGAHHVAVLTSR

FPrintScan: PR00633
IPR000408
538-559 RCCNDNSATION
Regulator of chromosome condensation, RCC1

VLTSRSEVFTWGKGANGRLGHG

ProfileScan: PS50012
IPR000408
543-594 RCC1_3
Regulator of chromosome condensation, RCC1

SEVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFTSSICIH

HMMPfam: PF00415
IPR000408
544-588 RCC1
Regulator of chromosome condensation, RCC1

EVFTWGKGANGRLGHGDTEDKRTPTLVEALRDRHVKSLSCGSNFT

HMMSmart: SM00064
IPR000306
593-662 FYVE
Zinc finger, FYVE-type

IHKWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLKA

superfamily: SSF57903
IPR011011
594-665 FYVE_PHD_ZnF
Zinc finger, FYVE/PHD-type

HKWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLKAAES

Gene3D: G3DSA:3.30.40.10
IPR013083
595-662 Znf_RING/FYVE/PHD
Zinc finger, RING/FYVE/PHD-type

KWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLKA

HMMPfam: PF01363
IPR000306
595-661 FYVE
Zinc finger, FYVE-type

KWVSGADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLK

ProfileScan: PS50178
IPR017455
599-661 ZF_FYVE
Zinc finger, FYVE-related

GADQSICSGCRQAFGFTRKRHNCYNCGLVHCHACSSKKALKAALAPTPGKPHRVCDACYSKLK

HMMPfam: PF13713
845-881 BRX_N,Transcription factor BRX N-terminal domain

RQSSKHKAATEALKSVAEQLKELKEKLPPEVSESEAF

HMMPfam: PF08381
IPR013591
947-1003 BRX
Brevis radix-like domain

GKESKEQFEPGVYVTYEVDMNGNKIFRRVRFSKKRFDEHQAEDWWTKNKDRLLKCYS

ProfileScan: PS51514
IPR013591
948-1003 BRX
Brevis radix-like domain

KESKEQFEPGVYVTYEVDMNGNKIFRRVRFSKKRFDEHQAEDWWTKNKDRLLKCYS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox