PRGDB00049834 (EDS1)

From PRG Wiki
Jump to: navigation, search
EDS1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 186510773 (NM_114678)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana EDS1 (ENHANCED DISEASE SUSCEPTIBILITY 1); signal transducer/ triacylglycerol lipase (EDS1) mRNA, complete cds.

DNA Sequence

ATGGCGTTTGAAGCTCTTACCGGAATCAATGGTGATCTAATCACCAGATCATGGTCAGCCTCGAAGCAAGCTTACCTAACCGAGCGCTATCACAAGGAAGAAGCAGGAGCAGTCGTAATCTTCGCTTTCCAACCATCTTTCTCAGAGAAAGATTTCTTCGATCCGGACAATAAATCTTCCTTTGGAGAAATCAAGTTGAACCGTGTTCAGTTTCCTTGTATGAGGAAAATCGGTAAAGGTGATGTAGCTACTGTTAACGAAGCTTTCCTCAAGAATCTTGAAGCTATCATTGATCCAAGAACCTCATTTCAAGCTTCTGTGGAAATGGCTGTGAGGAGTAGAAAACAGATAGTGTTCACAGGACATTCCTCAGGAGGTGCAACTGCAATCTTAGCAACAGTTTGGTATTTGGAGAAATACTTCATACGCAATCCAAATGTTTACCTTGAGCCTCGTTGTGTGACATTTGGAGCTCCTTTGGTTGGTGACTCTATCTTCAGTCACGCACTTGGGAGAGAAAAATGGAGCCGGTTCTTTGTGAACTTTGTCTCAAGATTCGATATTGTCCCTCGGATTATGCTTGCTCGAAAGGCGTCTGTAGAGGAAACTTTGCCTCATGTTCTTGCCCAATTGGATCCCAGAAAGTCTTCCGTCCAAGAGAGTGAACAGAGAATAACAGAGTTTTACACAAGGGTGATGCGAGACACATCAACTGTTGCAAACCAAGCTGTTTGTGAATTGACTGGAAGCGCAGAGGCGTTTTTAGAGACCCTTTCTAGTTTCCTTGAGCTAAGTCCTTATAGACCCGCCGGTACTTTTGTTTTCTCTACAGAGAAGAGATTGGTTGCAGTGAACAACTCGGACGCCATTCTTCAAATGCTGTTTTACACTTCTCAAGCCAGCGATGAACAAGAATGGTCTCTAATTCCATTTCGAAGTATCAGAGATCATCATAGCTATGAGGAACTGGTACAGTCGATGGGAAAGAAGTTGTTTAATCATTTGGATGGAGAAAACTCAATAGAGTCTACGCTCAATGACCTTGGAGTGAGCACAAGAGGCAGACAGTACGTTCAAGCTGCATTAGAGGAAGAGAAGAAACGAGTAGAGAATCAGAAGAAGATTATTCAGGTGATCGAGCAAGAGAGGTTTTTAAAGAAACTAGCATGGATAGAAGATGAATACAAGCCAAAGTGTCAAGCCCATAAAAATGGGTATTATGATTCCTTCAAAGTTTCAAATGAAGAGAATGACTTCAAAGCAAACGTCAAGAGAGCTGAGTTAGCCGGTGTTTTTGACGAGGTGCTTGGTTTAATGAAGAAATGTCAACTTCCAGATGAGTTCGAAGGGGACATAGATTGGATCAAGTTAGCAACTCGATACCGCAGATTAGTTGAGCCTCTTGATATTGCAAACTACCATCGACATTTAAAGAACGAAGACACAGGGCCGTACATGAAAAGAGGAAGACCAACCCGCTACATATATGCTCAGAGAGGCTACGAACATTATATACTGAAGCCAAACGGAATGATTGCAGAAGATGTATTTTGGAACAAGGTAAATGGTCTTAACTTAGGGTTACAGCTAGAAGAAATTCAAGAGACTCTAAAGAATTCGGGATCCGAGTGCGGATCATGCTTTTGGGCTGAGGTTGAAGAACTCAAAGGAAAGCCATACGAGGAAGTTGAGGTAAGAGTTAAGACATTAGAAGGGATGCTTGGAGAATGGATCACAGACGGGGAGGTAGATGATAAGGAAATATTTCTGGAGGGTTCAACGTTTAGAAAGTGGTGGATTACGCTTCCCAAAAATCACAAATCGCATTCTCCTCTGCGAGACTATATGATGGATGAAATAACAGATACCTGA


Protein sequences

Name Description Sequence
EDS1 (ENHANCED DISEASE SUSCEPTIBILITY 1); signal transducer/ triacylglycerol lipase EDS1 (ENHANCED DISEASE SUSCEPTIBILITY 1); signal transducer/ triacylglycerol lipase [Arabidopsis thaliana].

MAFEALTGINGDLITRSWSASKQAYLTERYHKEEAGAVVIFAFQPSFSEKDFFDPDNKSSFGEIKLNRVQFPCMRKIGKGDVATVNEAFLKNLEAIIDPRTSFQASVEMAVRSRKQIVFTGHSSGGATAILATVWYLEKYFIRNPNVYLEPRCVTFGAPLVGDSIFSHALGREKWSRFFVNFVSRFDIVPRIMLARKASVEETLPHVLAQLDPRKSSVQESEQRITEFYTRVMRDTSTVANQAVCELTGSAEAFLETLSSFLELSPYRPAGTFVFSTEKRLVAVNNSDAILQMLFYTSQASDEQEWSLIPFRSIRDHHSYEELVQSMGKKLFNHLDGENSIESTLNDLGVSTRGRQYVQAALEEEKKRVENQKKIIQVIEQERFLKKLAWIEDEYKPKCQAHKNGYYDSFKVSNEENDFKANVKRAELAGVFDEVLGLMKKCQLPDEFEGDIDWIKLATRYRRLVEPLDIANYHRHLKNEDTGPYMKRGRPTRYIYAQRGYEHYILKPNGMIAEDVFWNKVNGLNLGLQLEEIQETLKNSGSECGSCFWAEVEELKGKPYEEVEVRVKTLEGMLGEWITDGEVDDKEIFLEGSTFRKWWITLPKNHKSHSPLRDYMMDEITDT

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.1820
39-196 G3DSA:3.40.50.1820

VIFAFQPSFSEKDFFDPDNKSSFGEIKLNRVQFPCMRKIGKGDVATVNEAFLKNLEAIIDPRTSFQASVEMAVRSRKQIVFTGHSSGGATAILATVWYLEKYFIRNPNVYLEPRCVTFGAPLVGDSIFSHALGREKWSRFFVNFVSRFDIVPRIMLAR

HMMPfam: PF01764
IPR002921
77-195 Lipase_3
Lipase, class 3

IGKGDVATVNEAFLKNLEAIIDPRTSFQASVEMAVRSRKQIVFTGHSSGGATAILATVWYLEKYFIRNPNVYLEPRCVTFGAPLVGDSIFSHALGREKWSRFFVNFVSRFDIVPRIMLA

superfamily: SSF53474
115-194 SSF53474

KQIVFTGHSSGGATAILATVWYLEKYFIRNPNVYLEPRCVTFGAPLVGDSIFSHALGREKWSRFFVNFVSRFDIVPRIML

Gene3D: G3DSA:3.40.50.1820
265-320 G3DSA:3.40.50.1820

SPYRPAGTFVFSTEKRLVAVNNSDAILQMLFYTSQASDEQEWSLIPFRSIRDHHSY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox