PRGDB00049835 (disease resistance protein-related / LRR protein-related)

From PRG Wiki
Jump to: navigation, search
disease resistance protein-related / LRR protein-related
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18401113 (NM_128195)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein-related / LRR protein-related (AT2G26380) mRNA, complete cds.

DNA Sequence

ATGAACTCTTGTTCTTTCCACAACTTCTTCATTTTCACCGCCGTGATCTTTCTCCGGTGTTTAAACCCCACCGCAGCAGCCACGTGTCATCCTGATGATGAGGCGGGTCTATTAGCTTTTAAATCGGGTATAACCAAAGATCCTTCAGGTATTCTAAGCACTTGGAAAAAAGGTACTGATTGCTGCTCTTGGAACGGTGTCAGTTGCCCTAACGGCAACCGTGTCGTCGTACTCACTATCCGCATAGAGTCCGACGATGCCGGAATCTTTCTCTCTGGCACAATCTCTCCGTCACTGGCCAAACTCCAGCATTTGGAAGGGGTCGTCTTTATCAATCTCAAAAACATCACAGGACCATTTCCACCATTTTTATTCAGATTACCACATCTAAAGTATGTTTACCTCGAGAATACACGTCTCTCTGGTCCTCTTCCAGCCAACATCGGCGCGCTTAACCGCTTAGATACATTAACCGTTAAAGGAAACCGGTTCATCGGTTCAATCCCGAGTTCCATATCCAATTTAACTCGGTTAAACTACCTAAATCTTGGCGGTAATCTCTTAACCGGAACAATACCGTTAGGGATTGCTAATCTCAAGCTCATTTCGAATCTTAATCTCGATGGAAACCGTCTCTCTGGAACCATCCCGGATATTTTCAAATCAATGACTAACCTTCGAATCCTCACTCTCTCACGCAACAGATTCTCCGGGAAGCTCCCTCCGTCGATTGCATCGCTCGCGCCGGTTCTTGCGTTCCTTGAGCTAGGTCAGAACAATCTCTCGGGGTCGATACCGAGCTATTTATCAAGATTCGTGGCGCTCGACACACTGGATCTCTCCAAGAACCGTTTCTCTGGAGCCGTGCCGAAGAGTTTGGCCAAGCTGACTAAAATTGCTAATATCAATCTCTCTCACAATCTTCTAACCAATCCATTCCCTGTTTTGAACGTGAAGAATTACATCTTGACTCTAGATCTGTCGTACAACAAGTTTCACATGGAAACAATCCCGGAATGGGTGACCTCAGCGTCGATCCTCGGCTCTTTGAAGTTGGCTAAATGTGGAATCAAGATGAGCTTAGACGATTGGAAAACAAGGCAAACTGATCTCTACGTTTCCATTGATCTTTCGGACAACGAGATCTCAGGGAGTCCACTGAGGTTCTTGAAGGGAGCAGAGCAACTACGGGAGTTTCGAATGTCGGGGAACAAACTCCGATTCGATTTGAGGAAGCTAAGTTTCTCGACGACGCTCGAGACGCTTGATCTATCAAGGAACTTAGTGTTCGGGAAAGTGCCGGCGAGGGTGGCCGGATTAAAGACACTTAACTTGAGTCAAAACCATCTTTGTGGGAAACTTCCGGTGACAAAGTTTCCAGAAAGTGTGTTTGCCGGCAACGACTGTCTATGCGGCTCCCCGCTAAGTCATTGTAAAGGTTAA


Protein sequences

Name Description Sequence
disease resistance protein-related / LRR protein-related disease resistance protein-related / LRR protein-related [Arabidopsis thaliana].

MNSCSFHNFFIFTAVIFLRCLNPTAAATCHPDDEAGLLAFKSGITKDPSGILSTWKKGTDCCSWNGVSCPNGNRVVVLTIRIESDDAGIFLSGTISPSLAKLQHLEGVVFINLKNITGPFPPFLFRLPHLKYVYLENTRLSGPLPANIGALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPLGIANLKLISNLNLDGNRLSGTIPDIFKSMTNLRILTLSRNRFSGKLPPSIASLAPVLAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGAVPKSLAKLTKIANINLSHNLLTNPFPVLNVKNYILTLDLSYNKFHMETIPEWVTSASILGSLKLAKCGIKMSLDDWKTRQTDLYVSIDLSDNEISGSPLRFLKGAEQLREFRMSGNKLRFDLRKLSFSTTLETLDLSRNLVFGKVPARVAGLKTLNLSQNHLCGKLPVTKFPESVFAGNDCLCGSPLSHCKG


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-476 PTHR24420,FAMILY NOT NAMED

MNSCSFHNFFIFTAVIFLRCLNPTAAATCHPDDEAGLLAFKSGITKDPSGILSTWKKGTDCCSWNGVSCPNGNRVVVLTIRIESDDAGIFLSGTISPSLAKLQHLEGVVFINLKNITGPFPPFLFRLPHLKYVYLENTRLSGPLPANIGALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPLGIANLKLISNLNLDGNRLSGTIPDIFKSMTNLRILTLSRNRFSGKLPPSIASLAPVLAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGAVPKSLAKLTKIANINLSHNLLTNPFPVLNVKNYILTLDLSYNKFHMETIPEWVTSASILGSLKLAKCGIKMSLDDWKTRQTDLYVSIDLSDNEISGSPLRFLKGAEQLREFRMSGNKLRFDLRKLSFSTTLETLDLSRNLVFGKVPARVAGLKTLNLSQNHLCGKLPVTKFPESVFAGNDCLCGSPLS

HMMPanther: PTHR24420:SF510
1-476 PTHR24420:SF510

MNSCSFHNFFIFTAVIFLRCLNPTAAATCHPDDEAGLLAFKSGITKDPSGILSTWKKGTDCCSWNGVSCPNGNRVVVLTIRIESDDAGIFLSGTISPSLAKLQHLEGVVFINLKNITGPFPPFLFRLPHLKYVYLENTRLSGPLPANIGALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPLGIANLKLISNLNLDGNRLSGTIPDIFKSMTNLRILTLSRNRFSGKLPPSIASLAPVLAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGAVPKSLAKLTKIANINLSHNLLTNPFPVLNVKNYILTLDLSYNKFHMETIPEWVTSASILGSLKLAKCGIKMSLDDWKTRQTDLYVSIDLSDNEISGSPLRFLKGAEQLREFRMSGNKLRFDLRKLSFSTTLETLDLSRNLVFGKVPARVAGLKTLNLSQNHLCGKLPVTKFPESVFAGNDCLCGSPLS

superfamily: SSF52058
27-312 SSF52058,LRR

ATCHPDDEAGLLAFKSGITKDPSGILSTWKKGTDCCSWNGVSCPNGNRVVVLTIRIESDDAGIFLSGTISPSLAKLQHLEGVVFINLKNITGPFPPFLFRLPHLKYVYLENTRLSGPLPANIGALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPLGIANLKLISNLNLDGNRLSGTIPDIFKSMTNLRILTLSRNRFSGKLPPSIASLAPVLAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGAVPKSLAKLTKIANINLSHNLLTNP

Gene3D: G3DSA:3.80.10.10
28-314 G3DSA:3.80.10.10

TCHPDDEAGLLAFKSGITKDPSGILSTWKKGTDCCSWNGVSCPNGNRVVVLTIRIESDDAGIFLSGTISPSLAKLQHLEGVVFINLKNITGPFPPFLFRLPHLKYVYLENTRLSGPLPANIGALNRLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPLGIANLKLISNLNLDGNRLSGTIPDIFKSMTNLRILTLSRNRFSGKLPPSIASLAPVLAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGAVPKSLAKLTKIANINLSHNLLTNPFP

HMMPfam: PF08263
IPR013210
31-69 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKSGITKDPSGILSTWKKGTDCCSWNGVSC

HMMPfam: PF13855
153-212 LRR_8,Leucine rich repeat

RLDTLTVKGNRFIGSIPSSISNLTRLNYLNLGGNLLTGTIPLGIANLKLISNLNLDGNRL

HMMPfam: PF00560
IPR001611
225-247 LRR_1
Leucine-rich repeat

NLRILTLSRNRFSGKLPPSIASL

superfamily: SSF52058
242-455 SSF52058,LRR

PSIASLAPVLAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGAVPKSLAKLTKIANINLSHNLLTNPFPVLNVKNYILTLDLSYNKFHMETIPEWVTSASILGSLKLAKCGIKMSLDDWKTRQTDLYVSIDLSDNEISGSPLRFLKGAEQLREFRMSGNKLRFDLRKLSFSTTLETLDLSRNLVFGKVPARVAGLKTLNLSQNHLCGKLP

HMMPfam: PF13855
251-309 LRR_8,Leucine rich repeat

LAFLELGQNNLSGSIPSYLSRFVALDTLDLSKNRFSGAVPKSLAKLTKIANINLSHNLL

Gene3D: G3DSA:3.80.10.10
324-459 G3DSA:3.80.10.10

TLDLSYNKFHMETIPEWVTSASILGSLKLAKCGIKMSLDDWKTRQTDLYVSIDLSDNEISGSPLRFLKGAEQLREFRMSGNKLRFDLRKLSFSTTLETLDLSRNLVFGKVPARVAGLKTLNLSQNHLCGKLPVTKF

HMMPfam: PF00560
IPR001611
440-459 LRR_1
Leucine-rich repeat

LKTLNLSQNHLCGKLPVTKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox