PRGDB00049836 (disease resistance protein-related)

From PRG Wiki
Jump to: navigation, search
disease resistance protein-related
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 30685416 (NM_101623)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana disease resistance protein-related (AT1G17610) mRNA, complete cds.

DNA Sequence

ATGTCTACTTCTTATTCTTTTTTGTTGGCTGGAAGAGAGTTGGATGTGTTCTTGAGTTTCAGCGGTAAGATAGCTCTTGACGTTGATTTTGGTTATGATTTGTCACGAAATGGTATCAAAGCTTTTAAATCCGAAAGCTGGAAGGAGAGTAGCTTCAAACCAATTGATCTACGAACGCTTGAGGCTTTGACAGAGTCCAAAGTTGCAGTTGTCATGACGTCTGATGAAGAAGTTTCTTCAGTTGGGTTCCTTGAAGAGCTCATTGTAATAATTGAGTTTCAAGAGAAACGTTCACTCACTGTCATACCAGTCTTCCTCACAAAACACCCTTTGGATGTGGAAAAAGTCTCTCAAATATTTCCTGAGAGAGCCAAAATTTGGAGGACTGCAATTGCCAAACTGGACAACATAGCTGCACAGTACTCGTTTTCTCGGAATCTTGCGGTGATGCACGGAACACACCGGATCAAGCAGATTGCTGATGACATTAGGCTTATGTTTCTGTCCTCTGCATCAAGCGATTTCAAAGGCCTTGCAGGAATGGACCGTCACATGAAAGCATTGTATGCGTTGTTGGCTTTAGAATCTGACGAAAAGGTTCGTACCATTGGTATTTGGGGTAGTTCAGGTGTGGGAAAGACAACACTTGCAAGGTACACTTATGCAGAGATCTCTGTTAAATTTCAGGCGCATGTTTTCCTAGAAAACGTCGAAAACATGAAAGAAATGCTTCTACCGTCAGAAAACTTTGAAGGGGAAGATCTTAGAAGTGTGAATCATGAGATGAATGAAATGGCGGAAGCAAAGCAAAAACACCGGAAAGTTCTTTTGATAGCTGATGGTGTGAACAACATTGAACAAGGAAAGTGGATCGCGGAGAACGCCAACTGGTTTGCTCCAGGAAGTAGAGTCATTCTAATCACTCAAGAAAAAAGTTTGCTTGTGCAATCAGGAGTGAATCATGTGTATGAAGTTGGTTCTCTAAGATATGATGAAGCTCTCCAACTCTTCTCACGTTTTGCTTTCAAGCAGCCATATCCTTCTCCTGATTTTGAACGCCTCTCAGTTCGTGCTGTTCAGCTTGCAGGGTTTCTTCCTGTGACCATTAGACTGTTTGGTTCGTTTTTAACTGGTAGAGATAAAGAGGAGTGGGAAGCTACACTGCTTAAACTCAATGCAAAGCAAGGTAAAGACATAAAGGAAGTTTGGAAGATTATGGAAGCATTAGAAGATAAAGATATCGTGGAAGCATCCCAAAGATAA


Protein sequences

Name Description Sequence
disease resistance protein-related disease resistance protein-related [Arabidopsis thaliana].

MSTSYSFLLAGRELDVFLSFSGKIALDVDFGYDLSRNGIKAFKSESWKESSFKPIDLRTLEALTESKVAVVMTSDEEVSSVGFLEELIVIIEFQEKRSLTVIPVFLTKHPLDVEKVSQIFPERAKIWRTAIAKLDNIAAQYSFSRNLAVMHGTHRIKQIADDIRLMFLSSASSDFKGLAGMDRHMKALYALLALESDEKVRTIGIWGSSGVGKTTLARYTYAEISVKFQAHVFLENVENMKEMLLPSENFEGEDLRSVNHEMNEMAEAKQKHRKVLLIADGVNNIEQGKWIAENANWFAPGSRVILITQEKSLLVQSGVNHVYEVGSLRYDEALQLFSRFAFKQPYPSPDFERLSVRAVQLAGFLPVTIRLFGSFLTGRDKEEWEATLLKLNAKQGKDIKEVWKIMEALEDKDIVEASQR

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
2-140 TIR
Toll/interleukin-1 receptor homology (TIR) domain

STSYSFLLAGRELDVFLSFSGKIALDVDFGYDLSRNGIKAFKSESWKESSFKPIDLRTLEALTESKVAVVMTSDEEVSSVGFLEELIVIIEFQEKRSLTVIPVFLTKHPLDVEKVSQIFPERAKIWRTAIAKLDNIAAQ

HMMPanther: PTHR11017:SF20
28-409 PTHR11017:SF20,SUBFAMILY NOT NAMED

VDFGYDLSRNGIKAFKSESWKESSFKPIDLRTLEALTESKVAVVMTSDEEVSSVGFLEELIVIIEFQEKRSLTVIPVFLTKHPLDVEKVSQIFPERAKIWRTAIAKLDNIAAQYSFSRNLAVMHGTHRIKQIADDIRLMFLSSASSDFKGLAGMDRHMKALYALLALESDEKVRTIGIWGSSGVGKTTLARYTYAEISVKFQAHVFLENVENMKEMLLPSENFEGEDLRSVNHEMNEMAEAKQKHRKVLLIADGVNNIEQGKWIAENANWFAPGSRVILITQEKSLLVQSGVNHVYEVGSLRYDEALQLFSRFAFKQPYPSPDFERLSVRAVQLAGFLPVTIRLFGSFLTGRDKEEWEATLLKLNAKQGKDIKEVWKIMEAL

HMMPanther: PTHR11017
28-409 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VDFGYDLSRNGIKAFKSESWKESSFKPIDLRTLEALTESKVAVVMTSDEEVSSVGFLEELIVIIEFQEKRSLTVIPVFLTKHPLDVEKVSQIFPERAKIWRTAIAKLDNIAAQYSFSRNLAVMHGTHRIKQIADDIRLMFLSSASSDFKGLAGMDRHMKALYALLALESDEKVRTIGIWGSSGVGKTTLARYTYAEISVKFQAHVFLENVENMKEMLLPSENFEGEDLRSVNHEMNEMAEAKQKHRKVLLIADGVNNIEQGKWIAENANWFAPGSRVILITQEKSLLVQSGVNHVYEVGSLRYDEALQLFSRFAFKQPYPSPDFERLSVRAVQLAGFLPVTIRLFGSFLTGRDKEEWEATLLKLNAKQGKDIKEVWKIMEAL

Gene3D: G3DSA:3.40.50.300
158-215 G3DSA:3.40.50.300

QIADDIRLMFLSSASSDFKGLAGMDRHMKALYALLALESDEKVRTIGIWGSSGVGKTT

superfamily: SSF52540
161-399 SSF52540

DDIRLMFLSSASSDFKGLAGMDRHMKALYALLALESDEKVRTIGIWGSSGVGKTTLARYTYAEISVKFQAHVFLENVENMKEMLLPSENFEGEDLRSVNHEMNEMAEAKQKHRKVLLIADGVNNIEQGKWIAENANWFAPGSRVILITQEKSLLVQSGVNHVYEVGSLRYDEALQLFSRFAFKQPYPSPDFERLSVRAVQLAGFLPVTIRLFGSFLTGRDKEEWEATLLKLNAKQGKDI

HMMPfam: PF00931
IPR002182
183-406 NB-ARC,NBS
NB-ARC

RHMKALYALLALESDEKVRTIGIWGSSGVGKTTLARYTYAEISVKFQAHVFLENVENMKEMLLPSENFEGEDLRSVNHEMNEMAEAKQKHRKVLLIADGVNNIEQGKWIAENANWFAPGSRVILITQEKSLLVQSGVNHVYEVGSLRYDEALQLFSRFAFKQPYPSPDFERLSVRAVQLAGFLPVTIRLFGSFLTGRDKEEWEATLLKLNAKQGKDIKEVWKIM

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

TIGIWGSSGVGKTTLA

Gene3D: G3DSA:3.40.50.300
216-279 G3DSA:3.40.50.300

LARYTYAEISVKFQAHVFLENVENMKEMLLPSENFEGEDLRSVNHEMNEMAEAKQKHRKVLLIA

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

KQKHRKVLLIADGVN

FPrintScan: PR00364
IPR000767
362-376 DISEASERSIST
Disease resistance protein

AGFLPVTIRLFGSFL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox