PRGDB00049838 (leucine-rich repeat family protein)

From PRG Wiki
Jump to: navigation, search
leucine-rich repeat family protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 18398933 (NM_103087)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana leucine-rich repeat family protein (AT1G33670) mRNA, complete cds.

DNA Sequence

ATGAACTCTTGTTCCTTCCCTCTCTTCCTCTTTGTTATCTTTCTCCGGTGTTTAAGTTCCACGGGAGCTGCCACATGTCATCCTGATGACAAAGCGGGTCTTTTAGCTTTCAAATCGGGTATAACCCAAGATCCTTCGGGTATTCTCAGCTCATGGCAGAAAGATATTGACTGCTGCTCCTGGTACGGTATCTTTTGCCTCCCTACGATTCATGGCGACCGCGTCACCATGATGGCATTAGACGGAAATACGGATGTTGGTGAAACCTTTCTCTCCGGCACTATCTCACCGTTGCTCGCCAAACTCCATCACCTCAACGAGATTCGCCTCACCAATCTTCGAAAGATCACTGGATCTTTTCCCCACTTCCTCTTCAAATTACCAAAGCTAAGGACTGTTTACTTAGAGAATAACCGTCTCTCTGGTCCCCTTCCTGCCAACATCGGTGCACTAAGTAATTTGGAAATTTTGAGTGTGGCGGGAAACCGGTTCAGCGGTTCGATCCCAAGTTCGATGTCTAAGTTAACTAGCTTACTCCAACTCAAGCTCAACGGTAACCGCCTTTCTGGCATCTTCCCAGACATATTCAAATCCATGCGGCAACTTCGATTTCTTGATCTCTCCAGCAACAGATTCTCTGGAAACCTTCCTTCATCGATTGCATCTCTTGCACCGACTCTTTCTACCCTTGAGGTGGGCCATAACAAGCTATCGGGGACTATCCCGGACTATTTATCGAGATTCGAGCTTCTCTCCGCATTAAATCTCTCTAGGAATGGGTACACAGGGGTCGTGCCGATGAGTTTTGCCAATCTGACCAACATTATCTTTCTTGATCTCTCCCACAATCTGCTTACCGGTCCATTCCCTGTCTTGAACTCATTAGGCATCGAATATCTACATCTTTCGTACAACCGATTTCACCTTGAAACAATCCCCGAATGGGTGACCTTGTCGAAGTTCATCTACTCATTGAAGCTTGCAAAATGTGGGATCAAAATGAGCTTAGACCATTGGATGCCAGCAGACACCTCTTTCTACCATCACATTGATTTTTCGGAAAACGAGATCTCAGGGAGTCCAATAAGGTTTTTTAACCAGATGGATTTTATGGTGGAGTTCCATGCACCGGGGAACAAACTCCAGTTCGACTTGGGGAAGCTAAAGTTTGGAATCTTCTTGAAAACCCTGGATTTGTCAAGGAACTTGGTATTTGGGAAGGTACCGGTGACGGTGACCAGACTGCAGACACTAAACTTGAGTCAAAACCATCTTTGCGGAAAGCTTCCATCGACAAAGTTCCCGGCTAGTGCTTTTGTCGATAACAAGTGTCTTTGCGGCTTTCCACTTTCTCCTTGTAAAGCTTAG


Protein sequences

Name Description Sequence
leucine-rich repeat family protein leucine-rich repeat family protein [Arabidopsis thaliana].

MNSCSFPLFLFVIFLRCLSSTGAATCHPDDKAGLLAFKSGITQDPSGILSSWQKDIDCCSWYGIFCLPTIHGDRVTMMALDGNTDVGETFLSGTISPLLAKLHHLNEIRLTNLRKITGSFPHFLFKLPKLRTVYLENNRLSGPLPANIGALSNLEILSVAGNRFSGSIPSSMSKLTSLLQLKLNGNRLSGIFPDIFKSMRQLRFLDLSSNRFSGNLPSSIASLAPTLSTLEVGHNKLSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFLDLSHNLLTGPFPVLNSLGIEYLHLSYNRFHLETIPEWVTLSKFIYSLKLAKCGIKMSLDHWMPADTSFYHHIDFSENEISGSPIRFFNQMDFMVEFHAPGNKLQFDLGKLKFGIFLKTLDLSRNLVFGKVPVTVTRLQTLNLSQNHLCGKLPSTKFPASAFVDNKCLCGFPLSPCKA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF507
6-454 PTHR24420:SF507

FPLFLFVIFLRCLSSTGAATCHPDDKAGLLAFKSGITQDPSGILSSWQKDIDCCSWYGIFCLPTIHGDRVTMMALDGNTDVGETFLSGTISPLLAKLHHLNEIRLTNLRKITGSFPHFLFKLPKLRTVYLENNRLSGPLPANIGALSNLEILSVAGNRFSGSIPSSMSKLTSLLQLKLNGNRLSGIFPDIFKSMRQLRFLDLSSNRFSGNLPSSIASLAPTLSTLEVGHNKLSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFLDLSHNLLTGPFPVLNSLGIEYLHLSYNRFHLETIPEWVTLSKFIYSLKLAKCGIKMSLDHWMPADTSFYHHIDFSENEISGSPIRFFNQMDFMVEFHAPGNKLQFDLGKLKFGIFLKTLDLSRNLVFGKVPVTVTRLQTLNLSQNHLCGKLPSTKFPASAFVDNKCLCGFPLSPCK

HMMPanther: PTHR24420
6-454 PTHR24420,FAMILY NOT NAMED

FPLFLFVIFLRCLSSTGAATCHPDDKAGLLAFKSGITQDPSGILSSWQKDIDCCSWYGIFCLPTIHGDRVTMMALDGNTDVGETFLSGTISPLLAKLHHLNEIRLTNLRKITGSFPHFLFKLPKLRTVYLENNRLSGPLPANIGALSNLEILSVAGNRFSGSIPSSMSKLTSLLQLKLNGNRLSGIFPDIFKSMRQLRFLDLSSNRFSGNLPSSIASLAPTLSTLEVGHNKLSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFLDLSHNLLTGPFPVLNSLGIEYLHLSYNRFHLETIPEWVTLSKFIYSLKLAKCGIKMSLDHWMPADTSFYHHIDFSENEISGSPIRFFNQMDFMVEFHAPGNKLQFDLGKLKFGIFLKTLDLSRNLVFGKVPVTVTRLQTLNLSQNHLCGKLPSTKFPASAFVDNKCLCGFPLSPCK

Gene3D: G3DSA:3.80.10.10
25-290 G3DSA:3.80.10.10

TCHPDDKAGLLAFKSGITQDPSGILSSWQKDIDCCSWYGIFCLPTIHGDRVTMMALDGNTDVGETFLSGTISPLLAKLHHLNEIRLTNLRKITGSFPHFLFKLPKLRTVYLENNRLSGPLPANIGALSNLEILSVAGNRFSGSIPSSMSKLTSLLQLKLNGNRLSGIFPDIFKSMRQLRFLDLSSNRFSGNLPSSIASLAPTLSTLEVGHNKLSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFLDLSHNLLTGPFP

HMMPfam: PF08263
IPR013210
28-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDKAGLLAFKSGITQDPSGILSSWQKDIDCCSWYGIFC

superfamily: SSF52058
55-424 SSF52058,LRR

DIDCCSWYGIFCLPTIHGDRVTMMALDGNTDVGETFLSGTISPLLAKLHHLNEIRLTNLRKITGSFPHFLFKLPKLRTVYLENNRLSGPLPANIGALSNLEILSVAGNRFSGSIPSSMSKLTSLLQLKLNGNRLSGIFPDIFKSMRQLRFLDLSSNRFSGNLPSSIASLAPTLSTLEVGHNKLSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFLDLSHNLLTGPFPVLNSLGIEYLHLSYNRFHLETIPEWVTLSKFIYSLKLAKCGIKMSLDHWMPADTSFYHHIDFSENEISGSPIRFFNQMDFMVEFHAPGNKLQFDLGKLKFGIFLKTLDLSRNLVFGKVPVTVTRLQTLNLSQNH

HMMPfam: PF13855
152-212 LRR_8,Leucine rich repeat

SNLEILSVAGNRFSGSIPSSMSKLTSLLQLKLNGNRLSGIFPDIFKSMRQLRFLDLSSNRF

HMMPfam: PF13855
225-285 LRR_8,Leucine rich repeat

PTLSTLEVGHNKLSGTIPDYLSRFELLSALNLSRNGYTGVVPMSFANLTNIIFLDLSHNLL

Gene3D: G3DSA:3.80.10.10
297-431 G3DSA:3.80.10.10

IEYLHLSYNRFHLETIPEWVTLSKFIYSLKLAKCGIKMSLDHWMPADTSFYHHIDFSENEISGSPIRFFNQMDFMVEFHAPGNKLQFDLGKLKFGIFLKTLDLSRNLVFGKVPVTVTRLQTLNLSQNHLCGKLPS

HMMPfam: PF00560
IPR001611
414-434 LRR_1
Leucine-rich repeat

RLQTLNLSQNHLCGKLPSTKF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox