PRGDB00049845 (Os12g0565200)

From PRG Wiki
Jump to: navigation, search
Os12g0565200
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115489117 (NM_001073578)
Gene Class CNL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0565200 (Os12g0565200) mRNA, complete cds.

DNA Sequence

ATGTGGGGCCAGTCTGCAACGGCGGCAGTTGACTTTGCTGCTAACCCACTCCACTCAGTTCCAGCTGCAAGCGTTATGACGAGGCCATCTAGGCCAGTTAAGAAACCATTAGGTGATTCCTTGTCTTGTGCTCCTCAAAACACAAGGATCATTGATCTGGGTGGTGAGATGGCAAGTGCCTTGACAGGGGCGATGACCTCAGTCATCATCAAGCTCAGTGCACTTCTTGGGGAGGAGTACGCAAAGCTGAAAGGATTACAGAGGGAGGTGGAGTTTATGAAAGATGAGCTGAGCAGCATGAATGCTCTCCTTCATAGGCTGGCAGAGGTAGACTCTGACCTCGATGTGCAAACGGAGGAGTGGAGAAACCAAGTACGGGAGATGTCTTATGACATCGAGGATTGTATCGACGGTTTCACACATCGCCTTGGCCACATTGGCATAGCTGAGGCTGCAGGGCCTGTCCAAAGGGTGGCCCAACAACTCAAGGTGCTCAAGGTGCGCCGTCAAATCGCCAGCCAAATCCAAGAGCTCAAGGGACGAGTCGAAGATGCAAGCAAGCGGCGGATGAGGTATAAGCTTGACGATCGTATCTTTGAGCCTAGCATCGCGAGGGCAATTGACCCCCGTTTGCCTTCGCTGTATGCTGAGTCAGACGGGCTTGTTGGTATTGAGACGCCGAGAGCTGTGCTTGTCAAGTTGATAATGGAGGGAGACGATGCATCGTTTCAGCAGCTGAAGGTGATATCCATCGTGGGTCCTGGTGGTCTGGGTAAAACTACACTTGCGAATGAGGTGTACCGTAGACTGGAAGGCCAGTTCCAGTGTCGAGCTTTTGTTTCTCTGTCCCAGCAGCCTGACGTAAAAAGGATTCTGAGAAACATATTCTGCCAAGTTAGTCAGCAAGTGTATGATAGCACAAGTGTATGGGATGAGGAAAATCTTATCGATGCAATCAGAGGATTCCTAAAGGACAAGAGGAGTGCAATTGTAATTTCATATGGCAGGTACTTCATTGTCATTGATGATATCTGGAGTATTCAAGCATGGAAGACTATCAAATGCGCTTTGCTTATGAATAATCTTGGAAGCAGAATAATAACTACAACACGGAGTGTTACTATAGCCAAGTCATGTTGCTCTCCTCAACATGATCATGTCTATGAAATAATGCCTCTCAGTACAGCCAATGCAATGAGTTTATTTTTGAAACGAATATTTGGCACAGAAGATATATGCCCTCCCCAATTGGAAGAAATCTCCTGTAAAATATTGAAAAAATGTAGTGGATCTCCATTGGCGATTATTACCATAGCTAGCTTATTGACTAATAAAGCTAGTACAAAAGAAGAATGGGAGAGGGTACATAATTCAATTGGTTCGACACTGGAAAAAGATCCAAGTGTCGAAGAGATGCAGAGGATATTATCCCTTAGCTATGATGATCTTCCTCACCATTTGAAGACATGTCTACTATATCTATGCATATTTCCAGAAGACTGTGAGATTGAGAGAGACCAGCTGGTAAAGAGATGGATCGCCGAAGGGTTCATTAATACAGGAAGTGGACAAGATTTGGAGAAAATAGGCGAGTCGTATCTTAATGATCTTATCAGCAGAAGCATGATTCAGCCAGTGAAAGTTCGATATGATGGCCAGGTTGATTCATGCCGAATCCATGATATGATTCTTGATCTCCTTATGTCCAAGTCAATAAAGGAAAACTTTGCCACTTTCCTTGGTGAACAAAACCAGAAATTAGTGCTGCAAGGCAAGGTTCGCCGGCTCTCTCTCAGCTATTACTCCCAAGAGAATGTCATGGTTCCGTCAACAGCGATCATTTCCAGTTGTCGGTCACTCAGTATCTTTGGGTATGCCGAAGAAATGCCTTCTCTTTCAGAGTTTAGAGTTCTGCGAGTACTTGATATAGAACATGGTGAGGATATGGACAGCAATTATCTGGAGCATGTGAGGAGGCTTTCTCAGTTGAAGTACCTGAGACTGAATGTAAGAAGTATTGATGCACTCCCTGAACAACTCGGAGAACTACAGCATCTGCAGACTCTTGATCTGGTATCGACGAAACTTAGAAAATCACCCAAAAGCATTGTTCGGCTGCAAAATTTGACGTGTTTGCGTATCAATAATCTGGAGTTACCTGAAGGTATTGGGTGCATGCGAGCTCTTCAGGAGGTATCAGAGATCAAAATTAGCAGGAACAGTTCGGCGTCTTCTTTGCAGGAGCTGGGCAATCTGACCAAACTGAAGATTCTTGGGCTATGCTGGTGTATTTCTGATATTCATGGTGGGACTAAAACTTTGGTCAATAACTTGGTTTCATCGCTCCGCAAGCTGGGCAGACTCAACCTTCGATCTCTATGCATTCAGAGTAGTTTCAAGTACTCCATAGATTTCTTGCTGGATTCTTGGCTCCCCACACCACATCTCCTCCAGAAGTTTCAGATGGGCATGTGCTACTACTTCCCAAGAATCCCAGTTTGGATTGCATCACTTGAAAACCTCACCTACCTAGATATCAATCTTAATCCAGTAAAAGAGGAAGTATTGGAGATCCTCGGAAACTTACCCGCATTGCTGTTTCTCTGGCTGACGTCGAAATCGGCTGATCCAAAACAAAGACTCATCATAAACAGCAACATGTTCATGTGCCTGAAGGAACTCTACTTCACCTGCTGGAGCATTGAGTCAGGGTTGATGTTTCAAGAAGGCTGTATGGCAAAGCTTGAGAAGCTGCATCTTCCATTCCATGCTGCCACTGCCCTTGAATTTGGCATCCATCACCTCTCTTCCCTTAGGCTGCTTGTTGTTGAGATCATCTGCAGCGGCGCGACGATTCGGCAGGTGGAGTCATTGGAGGAGACCATCAGGAAGACAGCTGATCTCCTTCCTTACCGCCCCACGGTCGAAATTCGAACATGGGATGAGGAAAATATGGTGGAGGAACAGAAGGAGAAAGACATGGGAGAAGAGGGCACCCAAACAAGCTGTTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0565200 [Oryza sativa (japonica cultivar-group)].

MWGQSATAAVDFAANPLHSVPAASVMTRPSRPVKKPLGDSLSCAPQNTRIIDLGGEMASALTGAMTSVIIKLSALLGEEYAKLKGLQREVEFMKDELSSMNALLHRLAEVDSDLDVQTEEWRNQVREMSYDIEDCIDGFTHRLGHIGIAEAAGPVQRVAQQLKVLKVRRQIASQIQELKGRVEDASKRRMRYKLDDRIFEPSIARAIDPRLPSLYAESDGLVGIETPRAVLVKLIMEGDDASFQQLKVISIVGPGGLGKTTLANEVYRRLEGQFQCRAFVSLSQQPDVKRILRNIFCQVSQQVYDSTSVWDEENLIDAIRGFLKDKRSAIVISYGRYFIVIDDIWSIQAWKTIKCALLMNNLGSRIITTTRSVTIAKSCCSPQHDHVYEIMPLSTANAMSLFLKRIFGTEDICPPQLEEISCKILKKCSGSPLAIITIASLLTNKASTKEEWERVHNSIGSTLEKDPSVEEMQRILSLSYDDLPHHLKTCLLYLCIFPEDCEIERDQLVKRWIAEGFINTGSGQDLEKIGESYLNDLISRSMIQPVKVRYDGQVDSCRIHDMILDLLMSKSIKENFATFLGEQNQKLVLQGKVRRLSLSYYSQENVMVPSTAIISSCRSLSIFGYAEEMPSLSEFRVLRVLDIEHGEDMDSNYLEHVRRLSQLKYLRLNVRSIDALPEQLGELQHLQTLDLVSTKLRKSPKSIVRLQNLTCLRINNLELPEGIGCMRALQEVSEIKISRNSSASSLQELGNLTKLKILGLCWCISDIHGGTKTLVNNLVSSLRKLGRLNLRSLCIQSSFKYSIDFLLDSWLPTPHLLQKFQMGMCYYFPRIPVWIASLENLTYLDINLNPVKEEVLEILGNLPALLFLWLTSKSADPKQRLIINSNMFMCLKELYFTCWSIESGLMFQEGCMAKLEKLHLPFHAATALEFGIHHLSSLRLLVVEIICSGATIRQVESLEETIRKTADLLPYRPTVEIRTWDEENMVEEQKEKDMGEEGTQTSC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF229
61-994 OS12G0565100 PROTEIN,OS12G0565100 PROTEIN

LTGAMTSVIIKLSALLGEEYAKLKGLQREVEFMKDELSSMNALLHRLAEVDSDLDVQTEEWRNQVREMSYDIEDCIDGFTHRLGHIGIAEAAGPVQRVAQQLKVLKVRRQIASQIQELKGRVEDASKRRMRYKLDDRIFEPSIARAIDPRLPSLYAESDGLVGIETPRAVLVKLIMEGDDASFQQLKVISIVGPGGLGKTTLANEVYRRLEGQFQCRAFVSLSQQPDVKRILRNIFCQVSQQVYDSTSVWDEENLIDAIRGFLKDKRSAIVISYGRYFIVIDDIWSIQAWKTIKCALLMNNLGSRIITTTRSVTIAKSCCSPQHDHVYEIMPLSTANAMSLFLKRIFGTEDICPPQLEEISCKILKKCSGSPLAIITIASLLTNKASTKEEWERVHNSIGSTLEKDPSVEEMQRILSLSYDDLPHHLKTCLLYLCIFPEDCEIERDQLVKRWIAEGFINTGSGQDLEKIGESYLNDLISRSMIQPVKVRYDGQVDSCRIHDMILDLLMSKSIKENFATFLGEQNQKLVLQGKVRRLSLSYYSQENVMVPSTAIISSCRSLSIFGYAEEMPSLSEFRVLRVLDIEHGEDMDSNYLEHVRRLSQLKYLRLNVRSIDALPEQLGELQHLQTLDLVSTKLRKSPKSIVRLQNLTCLRINNLELPEGIGCMRALQEVSEIKISRNSSASSLQELGNLTKLKILGLCWCISDIHGGTKTLVNNLVSSLRKLGRLNLRSLCIQSSFKYSIDFLLDSWLPTPHLLQKFQMGMCYYFPRIPVWIASLENLTYLDINLNPVKEEVLEILGNLPALLFLWLTSKSADPKQRLIINSNMFMCLKELYFTCWSIESGLMFQEGCMAKLEKLHLPFHAATALEFGIHHLSSLRLLVVEIICSGATIRQVESLEETIRKTADLLPYRPTVEIRTWDEENMVEEQKEKDM

HMMPanther: PTHR23155
61-994 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTGAMTSVIIKLSALLGEEYAKLKGLQREVEFMKDELSSMNALLHRLAEVDSDLDVQTEEWRNQVREMSYDIEDCIDGFTHRLGHIGIAEAAGPVQRVAQQLKVLKVRRQIASQIQELKGRVEDASKRRMRYKLDDRIFEPSIARAIDPRLPSLYAESDGLVGIETPRAVLVKLIMEGDDASFQQLKVISIVGPGGLGKTTLANEVYRRLEGQFQCRAFVSLSQQPDVKRILRNIFCQVSQQVYDSTSVWDEENLIDAIRGFLKDKRSAIVISYGRYFIVIDDIWSIQAWKTIKCALLMNNLGSRIITTTRSVTIAKSCCSPQHDHVYEIMPLSTANAMSLFLKRIFGTEDICPPQLEEISCKILKKCSGSPLAIITIASLLTNKASTKEEWERVHNSIGSTLEKDPSVEEMQRILSLSYDDLPHHLKTCLLYLCIFPEDCEIERDQLVKRWIAEGFINTGSGQDLEKIGESYLNDLISRSMIQPVKVRYDGQVDSCRIHDMILDLLMSKSIKENFATFLGEQNQKLVLQGKVRRLSLSYYSQENVMVPSTAIISSCRSLSIFGYAEEMPSLSEFRVLRVLDIEHGEDMDSNYLEHVRRLSQLKYLRLNVRSIDALPEQLGELQHLQTLDLVSTKLRKSPKSIVRLQNLTCLRINNLELPEGIGCMRALQEVSEIKISRNSSASSLQELGNLTKLKILGLCWCISDIHGGTKTLVNNLVSSLRKLGRLNLRSLCIQSSFKYSIDFLLDSWLPTPHLLQKFQMGMCYYFPRIPVWIASLENLTYLDINLNPVKEEVLEILGNLPALLFLWLTSKSADPKQRLIINSNMFMCLKELYFTCWSIESGLMFQEGCMAKLEKLHLPFHAATALEFGIHHLSSLRLLVVEIICSGATIRQVESLEETIRKTADLLPYRPTVEIRTWDEENMVEEQKEKDM

Coil: coil
76-104 coiled-coil

LGEEYAKLKGLQREVEFMKDELSSMNALL

Coil: coil
168-196 coiled-coil

RRQIASQIQELKGRVEDASKRRMRYKLDD

superfamily: SSF52540
204-466 P-loop containing nucleoside triphosphate hydrolases

ARAIDPRLPSLYAESDGLVGIETPRAVLVKLIMEGDDASFQQLKVISIVGPGGLGKTTLANEVYRRLEGQFQCRAFVSLSQQPDVKRILRNIFCQVSQQVYDSTSVWDEENLIDAIRGFLKDKRSAIVISYGRYFIVIDDIWSIQAWKTIKCALLMNNLGSRIITTTRSVTIAKSCCSPQHDHVYEIMPLSTANAMSLFLKRIFGTEDICPPQLEEISCKILKKCSGSPLAIITIASLLTNKASTKEEWERVHNSIGSTLEKD

HMMPfam: PF00931
IPR002182
242-520 NB-ARC,NBS
NB-ARC

SFQQLKVISIVGPGGLGKTTLANEVYRRLEGQFQCRAFVSLSQQPDVKRILRNIFCQVSQQVYDSTSVWDEENLIDAIRGFLKDKRSAIVISYGRYFIVIDDIWSIQAWKTIKCALLMNNLGSRIITTTRSVTIAKSCCSPQHDHVYEIMPLSTANAMSLFLKRIFGTEDICPPQLEEISCKILKKCSGSPLAIITIASLLTNKASTKEEWERVHNSIGSTLEKDPSVEEMQRILSLSYDDLPHHLKTCLLYLCIFPEDCEIERDQLVKRWIAEGFINT

Gene3D: G3DSA:3.40.50.300
243-371 no description

FQQLKVISIVGPGGLGKTTLANEVYRRLEGQFQCRAFVSLSQQPDVKRILRNIFCQVSQQVYDSTSVWDEENLIDAIRGFLKDKRSAIVISYGRYFIVIDDIWSIQAWKTIKCALLMNNLGSRIITTTR

FPrintScan: PR00364
IPR000767
248-263 DISEASERSIST
Disease resistance protein

VISIVGPGGLGKTTLA

FPrintScan: PR00364
IPR000767
331-345 DISEASERSIST
Disease resistance protein

VISYGRYFIVIDDIW

Seg: seg
364-375 seg

SRIITTTRSVTI

FPrintScan: PR00364
IPR000767
428-442 DISEASERSIST
Disease resistance protein

CSGSPLAIITIASLL

superfamily: SSF52058
558-944 L domain-like,LRR

RIHDMILDLLMSKSIKENFATFLGEQNQKLVLQGKVRRLSLSYYSQENVMVPSTAIISSCRSLSIFGYAEEMPSLSEFRVLRVLDIEHGEDMDSNYLEHVRRLSQLKYLRLNVRSIDALPEQLGELQHLQTLDLVSTKLRKSPKSIVRLQNLTCLRINNLELPEGIGCMRALQEVSEIKISRNSSASSLQELGNLTKLKILGLCWCISDIHGGTKTLVNNLVSSLRKLGRLNLRSLCIQSSFKYSIDFLLDSWLPTPHLLQKFQMGMCYYFPRIPVWIASLENLTYLDINLNPVKEEVLEILGNLPALLFLWLTSKSADPKQRLIINSNMFMCLKELYFTCWSIESGLMFQEGCMAKLEKLHLPFHAATALEFGIHHLSSLRLLVVE

Gene3D: G3DSA:3.80.10.10
590-792 no description

QGKVRRLSLSYYSQENVMVPSTAIISSCRSLSIFGYAEEMPSLSEFRVLRVLDIEHGEDMDSNYLEHVRRLSQLKYLRLNVRSIDALPEQLGELQHLQTLDLVSTKLRKSPKSIVRLQNLTCLRINNLELPEGIGCMRALQEVSEIKISRNSSASSLQELGNLTKLKILGLCWCISDIHGGTKTLVNNLVSSLRKLGRLNLRS

FPrintScan: PR00364
IPR000767
681-697 DISEASERSIST
Disease resistance protein

GELQHLQTLDLVSTKLR

Gene3D: G3DSA:3.80.10.10
793-940 no description

LCIQSSFKYSIDFLLDSWLPTPHLLQKFQMGMCYYFPRIPVWIASLENLTYLDINLNPVKEEVLEILGNLPALLFLWLTSKSADPKQRLIINSNMFMCLKELYFTCWSIESGLMFQEGCMAKLEKLHLPFHAATALEFGIHHLSSLRL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox