PRGDB00049847 (Os12g0564800)

From PRG Wiki
Jump to: navigation, search
Os12g0564800
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115489111 (NM_001073575)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0564800 (Os12g0564800) mRNA, complete cds.

DNA Sequence

ATGGCGATTTCTTCCTCAGGCGCTGCGGTTCCATTGGCCGGTCTCTTGCAGAGCACACCATACCCACAAACAGAGAGGGGGATGGAAGCTGTTGTATGCGCATCACATGGAGCTGTAGGGTCCCTGCTATGGAAGCTAAGTGCCTTGCTCTCTGATGAATATAACCTTCTCACTGGTGTTAAGAGTAATATTATGTTCCTTAAAGCTGAGCTTGAGAGCATAGATGTTTTCCTCAAGAAGATGTATGAGTTTGAGGACCCCGATGAGCAATCTTTGTTCTGGATGAAGGAGTTCAGGGAGCTGTCCTATGACATTGAAGACATCATTGATGCTTCCATGTTCTCCCTTGGTCATGAGTCCAATCGCAGACCCCGTGGCTTCAAGGGGTTTGCTGGCAGGTGCATGGACTTCTTGACAAATGTCAAGACACGCCATTGGATTGCCAAGAAAATCCATTGTCTCAAATGCTGTGTTATAGAAGCTAGCAATCGGCGTGCAAGGTACAAGGTCGATGGTTCTGTCTCCAAACTGAGTAGGACAAGCTTAGACCCTCGCTTACCAGCATTCTACACAGAGACGACAAGGCTTGTTGGAATTGATGGCCCAAGGGATAAACTCATCAAGATGCTAGTGGAAGGGGACGACGCATTGGTGCATCAGCTGAAGGTGGTCTCCATTGTTGGATTTGGAGGCCTTGGAAAGACTACTCTTGCAAATGAAGTGTGCCGGAAGCTTGAAGGACAATTTAAGTATCAAGCTTTTGTGTCAGTGTCCCAAAAACCAGACATTAAGAAGATTCTGAGACATATACTCTCTCAGATCTGCTGGCGAGAGTGTATCAGTGATGAAGCATGGGATGAGCAGCAGCTCATCCACACAATAAGACAATTCCTTAAGGATAAGAGGTATTTTATTGTTATCGATGATATATGGAGCACATCAGCATGGAGAACAATCAAATGTGCTTTTCCCGAAAATAACTGTTCCAGTAGAATATTGACGACGACACGTATCATCGCAGTTGCTAAGTATTGTTGCTCACCTCACCATGACAATGTATATGAAATAAAGCCTCTTGGTGCAATTCACTCTAAAAGCTTATTTTTCAAACGAACTTTTGGTTCTGAAGATAAATGCCCTCTTCATCTGAAAGAAGTTTCTAATGCAATCTTGAGAAAATGTGGTGGCTTGCCACTGGGAATTATCACAGTAGCTAGCTTATTGGCTAATAAAGCTAGTACAAAAGAAGAATGGGAGAGCATACATAATTCTATTGGTTCAGCTCTTGAAAAAGATACAGATATGGAAGAAATGAAAAGGATATTGCTCCTTAGTTATGATGATCTTCCTTACCATTTGAAGACATGTTTGCTATATCTAAGTATTATTCCAGAAGATTACGAGATCAAGAGAGATCGGTTAATAAGGAGATGGATTGCTGAAGGTTTCATCCCTACAGAAGGGGTGCATGATATGGAGGAAGTAGGCGAATGCTATTTCAACGATCTTATCAACAGGAGTATGATTCTACCAGTTAATATCCAATATGATGGTCGAGCTGATGCTTGTCGTGTGCATGATATGATTCTTGATCTCATCATATCCATATCTGTCAAAGAAAATTTTGTAACCTTGCACGGTGACCAAAACTACAAAATAGTGCAACAAAATAAGGTTCGTCGCCTATCCCTCAACTATCATGCTCGAGAAGATATAATGATACCATCAAGTATGATTGTTTCTCATGTCCGATCCCTCACTATCTTTGGATATGCTGAACATATGCCTGCTCTGTCAAAATTGCAATTTATGCGAGTGTTAGATGTAGAAAATAAAATGGTGTTGGATCACAGTTTTCTCAAGCATATACACAGGCTTTCTCAATTGAAGTACCTGCGACTCAATGTAAGAAGAATCACTGCACTTCCTGAACAACTAGGAGAATTGCAGAATTTGCAGACCTTAGACTTAAGATGGACACAAATAAAGAAATTGCCATCTAGTATCGTTCGACTGCAGAAATTAGTATGCCTAAGGGTAAACAGTTTAGAATTGCCTGAAGGGATTGGAAATCTGCAAGCTCTACAGGAATTATCAGAGATTGAAATCAACCACAATACATCAGTGTATTCTCTGCAGGAGCTGGGAAATCTGAAGAAACTAAGAATTCTTGGGCTGAATTGGAGCATCAGTGATTCAAATTGTGACATCAAAATTTACGCAGATAACTTAGTCACGTCCCTCTGTAAACTAGGCATGTTCAATCTTCGATCTATACAAATTCAAGGTTATCATATTATTTCCCTTGATTTCTTACTGGATTCTTGGTTTCCTCCTCCTCATCTCCTCCAGAAATTTGAGATGTCCATAAGCTACTTTTTCCCCAGAATCCCAAAGTGGATAGAGTCACTTGAGTACCTCAGTTACCTAGACATCTACATCAACCCAGTGGATGAGGAAACATTCCAAATTCTTGCGGGCTTGCCGTCTTTAATATTTCTTTGGATATCCTCTAGAGCAGCAACCCCTAAAAAAGGGTTAATTATCAGCTATAATGGGTTCCAGTGTCTGAGGGAGCTCTACTTCACCTGTTGGGAAAGCAAGACAGGTATGATGTTTGAAGCAGGAGCCATGCCAAAACTTGAAAAGCTTCGGGTTCCATATAATGCATGTGATATATGCTCTTTGAATGGTGGTATGGATTTTGGCATCCAACACCTCTGTTCCCTGAAACATCTCCATGTTGAGATTATTTGCCGTGGTGCAAAGCTTCAGGAGGTGGAGGCCTTGGAGAATGCTATCAAAAGCGCAGCTGGCCTCCTTTCTGATGAGCTCACTTTTGAAGTAAGTAGATGGGATGAAGAAGAGATTATTGATATGGACCAAGAACTGGCAGAAGATGATTTTGATACAATTAATTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0564800 [Oryza sativa (japonica cultivar-group)].

MAISSSGAAVPLAGLLQSTPYPQTERGMEAVVCASHGAVGSLLWKLSALLSDEYNLLTGVKSNIMFLKAELESIDVFLKKMYEFEDPDEQSLFWMKEFRELSYDIEDIIDASMFSLGHESNRRPRGFKGFAGRCMDFLTNVKTRHWIAKKIHCLKCCVIEASNRRARYKVDGSVSKLSRTSLDPRLPAFYTETTRLVGIDGPRDKLIKMLVEGDDALVHQLKVVSIVGFGGLGKTTLANEVCRKLEGQFKYQAFVSVSQKPDIKKILRHILSQICWRECISDEAWDEQQLIHTIRQFLKDKRYFIVIDDIWSTSAWRTIKCAFPENNCSSRILTTTRIIAVAKYCCSPHHDNVYEIKPLGAIHSKSLFFKRTFGSEDKCPLHLKEVSNAILRKCGGLPLGIITVASLLANKASTKEEWESIHNSIGSALEKDTDMEEMKRILLLSYDDLPYHLKTCLLYLSIIPEDYEIKRDRLIRRWIAEGFIPTEGVHDMEEVGECYFNDLINRSMILPVNIQYDGRADACRVHDMILDLIISISVKENFVTLHGDQNYKIVQQNKVRRLSLNYHAREDIMIPSSMIVSHVRSLTIFGYAEHMPALSKLQFMRVLDVENKMVLDHSFLKHIHRLSQLKYLRLNVRRITALPEQLGELQNLQTLDLRWTQIKKLPSSIVRLQKLVCLRVNSLELPEGIGNLQALQELSEIEINHNTSVYSLQELGNLKKLRILGLNWSISDSNCDIKIYADNLVTSLCKLGMFNLRSIQIQGYHIISLDFLLDSWFPPPHLLQKFEMSISYFFPRIPKWIESLEYLSYLDIYINPVDEETFQILAGLPSLIFLWISSRAATPKKGLIISYNGFQCLRELYFTCWESKTGMMFEAGAMPKLEKLRVPYNACDICSLNGGMDFGIQHLCSLKHLHVEIICRGAKLQEVEALENAIKSAAGLLSDELTFEVSRWDEEEIIDMDQELAEDDFDTIN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
35-962 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SHGAVGSLLWKLSALLSDEYNLLTGVKSNIMFLKAELESIDVFLKKMYEFEDPDEQSLFWMKEFRELSYDIEDIIDASMFSLGHESNRRPRGFKGFAGRCMDFLTNVKTRHWIAKKIHCLKCCVIEASNRRARYKVDGSVSKLSRTSLDPRLPAFYTETTRLVGIDGPRDKLIKMLVEGDDALVHQLKVVSIVGFGGLGKTTLANEVCRKLEGQFKYQAFVSVSQKPDIKKILRHILSQICWRECISDEAWDEQQLIHTIRQFLKDKRYFIVIDDIWSTSAWRTIKCAFPENNCSSRILTTTRIIAVAKYCCSPHHDNVYEIKPLGAIHSKSLFFKRTFGSEDKCPLHLKEVSNAILRKCGGLPLGIITVASLLANKASTKEEWESIHNSIGSALEKDTDMEEMKRILLLSYDDLPYHLKTCLLYLSIIPEDYEIKRDRLIRRWIAEGFIPTEGVHDMEEVGECYFNDLINRSMILPVNIQYDGRADACRVHDMILDLIISISVKENFVTLHGDQNYKIVQQNKVRRLSLNYHAREDIMIPSSMIVSHVRSLTIFGYAEHMPALSKLQFMRVLDVENKMVLDHSFLKHIHRLSQLKYLRLNVRRITALPEQLGELQNLQTLDLRWTQIKKLPSSIVRLQKLVCLRVNSLELPEGIGNLQALQELSEIEINHNTSVYSLQELGNLKKLRILGLNWSISDSNCDIKIYADNLVTSLCKLGMFNLRSIQIQGYHIISLDFLLDSWFPPPHLLQKFEMSISYFFPRIPKWIESLEYLSYLDIYINPVDEETFQILAGLPSLIFLWISSRAATPKKGLIISYNGFQCLRELYFTCWESKTGMMFEAGAMPKLEKLRVPYNACDICSLNGGMDFGIQHLCSLKHLHVEIICRGAKLQEVEALENAIKSAAGLLSDELTFEVSRWDEEEIIDMDQ

HMMPanther: PTHR23155:SF228
35-962 PTHR23155:SF228,OS12G0564800 PROTEIN

SHGAVGSLLWKLSALLSDEYNLLTGVKSNIMFLKAELESIDVFLKKMYEFEDPDEQSLFWMKEFRELSYDIEDIIDASMFSLGHESNRRPRGFKGFAGRCMDFLTNVKTRHWIAKKIHCLKCCVIEASNRRARYKVDGSVSKLSRTSLDPRLPAFYTETTRLVGIDGPRDKLIKMLVEGDDALVHQLKVVSIVGFGGLGKTTLANEVCRKLEGQFKYQAFVSVSQKPDIKKILRHILSQICWRECISDEAWDEQQLIHTIRQFLKDKRYFIVIDDIWSTSAWRTIKCAFPENNCSSRILTTTRIIAVAKYCCSPHHDNVYEIKPLGAIHSKSLFFKRTFGSEDKCPLHLKEVSNAILRKCGGLPLGIITVASLLANKASTKEEWESIHNSIGSALEKDTDMEEMKRILLLSYDDLPYHLKTCLLYLSIIPEDYEIKRDRLIRRWIAEGFIPTEGVHDMEEVGECYFNDLINRSMILPVNIQYDGRADACRVHDMILDLIISISVKENFVTLHGDQNYKIVQQNKVRRLSLNYHAREDIMIPSSMIVSHVRSLTIFGYAEHMPALSKLQFMRVLDVENKMVLDHSFLKHIHRLSQLKYLRLNVRRITALPEQLGELQNLQTLDLRWTQIKKLPSSIVRLQKLVCLRVNSLELPEGIGNLQALQELSEIEINHNTSVYSLQELGNLKKLRILGLNWSISDSNCDIKIYADNLVTSLCKLGMFNLRSIQIQGYHIISLDFLLDSWFPPPHLLQKFEMSISYFFPRIPKWIESLEYLSYLDIYINPVDEETFQILAGLPSLIFLWISSRAATPKKGLIISYNGFQCLRELYFTCWESKTGMMFEAGAMPKLEKLRVPYNACDICSLNGGMDFGIQHLCSLKHLHVEIICRGAKLQEVEALENAIKSAAGLLSDELTFEVSRWDEEEIIDMDQ

superfamily: SSF52540
179-433 SSF52540

RTSLDPRLPAFYTETTRLVGIDGPRDKLIKMLVEGDDALVHQLKVVSIVGFGGLGKTTLANEVCRKLEGQFKYQAFVSVSQKPDIKKILRHILSQICWRECISDEAWDEQQLIHTIRQFLKDKRYFIVIDDIWSTSAWRTIKCAFPENNCSSRILTTTRIIAVAKYCCSPHHDNVYEIKPLGAIHSKSLFFKRTFGSEDKCPLHLKEVSNAILRKCGGLPLGIITVASLLANKASTKEEWESIHNSIGSALEKDT

Gene3D: G3DSA:3.40.50.300
203-322 G3DSA:3.40.50.300

RDKLIKMLVEGDDALVHQLKVVSIVGFGGLGKTTLANEVCRKLEGQFKYQAFVSVSQKPDIKKILRHILSQICWRECISDEAWDEQQLIHTIRQFLKDKRYFIVIDDIWSTSAWRTIKCA

HMMPfam: PF00931
IPR002182
204-486 NB-ARC,NBS
NB-ARC

DKLIKMLVEGDDALVHQLKVVSIVGFGGLGKTTLANEVCRKLEGQFKYQAFVSVSQKPDIKKILRHILSQICWRECISDEAWDEQQLIHTIRQFLKDKRYFIVIDDIWSTSAWRTIKCAFPENNCSSRILTTTRIIAVAKYCCSPHHDNVYEIKPLGAIHSKSLFFKRTFGSEDKCPLHLKEVSNAILRKCGGLPLGIITVASLLANKASTKEEWESIHNSIGSALEKDTDMEEMKRILLLSYDDLPYHLKTCLLYLSIIPEDYEIKRDRLIRRWIAEGFIPT

FPrintScan: PR00364
IPR000767
223-238 DISEASERSIST
Disease resistance protein

VVSIVGFGGLGKTTLA

FPrintScan: PR00364
IPR000767
297-311 DISEASERSIST
Disease resistance protein

FLKDKRYFIVIDDIW

FPrintScan: PR00364
IPR000767
394-408 DISEASERSIST
Disease resistance protein

CGGLPLGIITVASLL

superfamily: SSF52058
524-916 SSF52058,LRR

RVHDMILDLIISISVKENFVTLHGDQNYKIVQQNKVRRLSLNYHAREDIMIPSSMIVSHVRSLTIFGYAEHMPALSKLQFMRVLDVENKMVLDHSFLKHIHRLSQLKYLRLNVRRITALPEQLGELQNLQTLDLRWTQIKKLPSSIVRLQKLVCLRVNSLELPEGIGNLQALQELSEIEINHNTSVYSLQELGNLKKLRILGLNWSISDSNCDIKIYADNLVTSLCKLGMFNLRSIQIQGYHIISLDFLLDSWFPPPHLLQKFEMSISYFFPRIPKWIESLEYLSYLDIYINPVDEETFQILAGLPSLIFLWISSRAATPKKGLIISYNGFQCLRELYFTCWESKTGMMFEAGAMPKLEKLRVPYNACDICSLNGGMDFGIQHLCSLKHLHVE

Gene3D: G3DSA:3.80.10.10
598-721 G3DSA:3.80.10.10

LSKLQFMRVLDVENKMVLDHSFLKHIHRLSQLKYLRLNVRRITALPEQLGELQNLQTLDLRWTQIKKLPSSIVRLQKLVCLRVNSLELPEGIGNLQALQELSEIEINHNTSVYSLQELGNLKKL

FPrintScan: PR00364
IPR000767
647-663 DISEASERSIST
Disease resistance protein

GELQNLQTLDLRWTQIK

Gene3D: G3DSA:3.80.10.10
783-915 G3DSA:3.80.10.10

LQKFEMSISYFFPRIPKWIESLEYLSYLDIYINPVDEETFQILAGLPSLIFLWISSRAATPKKGLIISYNGFQCLRELYFTCWESKTGMMFEAGAMPKLEKLRVPYNACDICSLNGGMDFGIQHLCSLKHLHV


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox