PRGDB00049848 (Os12g0552900)

From PRG Wiki
Jump to: navigation, search
Os12g0552900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488997 (NM_001073518)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0552900 (Os12g0552900) mRNA, complete cds.

DNA Sequence

ATGAACGTTGCCACAGGGGCAATGAACACCCTACTCCCCAAGCTTGGGGAGCTGCTGGTAGGCGAATACAAGCTACAAAAGGGTGTCAAGGGAGAGATCGAAGAACTTGAGAAAGAGCTGACAAGTATGACCGCAGCCCTCCACAAGGTGGCTGAGACGCCTGCAGATAAACTTGATAAGCTGGCGAAGATCTGGGCCAGCGATGTCAGGGAGCTGTCTTACGACATCGAAGATGCCATCGACACCTTCATGATAAAGGGCAAGGGGCATGAACTTGCCACGAGCTTCAAGAAGGTCACCAATTTGTTCAACAAGTTCAAAACTAACCATCAGATTCACGGTGTCATCAAAGATATCATGGACCAGGTCAAGAAGGTCAGCGAGCGTCGTAGTAGGTACATAGTCGACGACATCGCTGCCAGACCAACTATTGTGGATGTTGATCCTCGCCTAGAAGCTATGTACCGGAAGGCAACAGAACTCGTTGGCATTAATGAGCCAAAAAGTGAGCTAACTAAGCGACTCTTGGAACATGACTACTCATCCAGGCAGCAATCAAATATAATTTCTATTGTTGGATTCGGAGGCTTGGGAAAGACAACTCTTGCCAATTCATTACTCCAGGAGCTTGAGGCAAAATTTGATTGCCATTTTTTTGTTTCGGTATCCTTGAAACCTGATATAAACAAGATTCTCAAAAGTATTCTTCCCCAACTTGACAAGAAAAGGTATGCCCACATAAATGAAGCATGGGAAACGAAGCAGTTCATTGATGAAATTCAAGACTTCCTCAAGAATAAAAGGTTCTTGTGCGTGATTGATGATGTTTGGGAAAAATCAGCGTGGGATGATATCAAACTTGCTGTGCAAGATGCTAAACTTGGTAGCAAGATAATTGTAACCACACGAAACATGGTCGTTGCTGAACATGCAGGTGGTGGTGTTTATGAAATGAAACCCTTATCTAATGATGATTCCAGACAATTGTTCTGCAAACGAATATTTGACTCTAACGATGACTGTCCAGGTGATTTGTGTGGTGTCACTGAGAAAATTTTGAAGAAATGCGGTGGTGTACCGCTAGCCATCATTACTACAGCATGCCTACTTGCTAGCAAACCAAGGAATTCAGAGGAATGGGACAAGGTCAATAAGTCTATCAGTTTGGGGCTTGAGAACAACCTTGATGTGGACAACATGCGGAAGATATTAAGCCTCAGTTACAACGATCTACCTTTTCATTTGAAGACTTGCTTGTTGTCTCTAAGCAAATATCCTGAGGATGAGCTAATTAGAAAAGATGTTTTGATATGGGGTTGGTTAGCAGAGGGTTTTATTACAGATGAAACACGACTTGCAGGGACAAGCTTGCAGGAGATTGGAGAGAGCTACTTCAGCGAGCTCATCAATCGAAGCTTGATCCAGCCGATGGATACTTACTTTCAATACGAAGATGGTAAGGTACATGAGTGCAGAGTACATGACATGGTGCTTGAGCTAATAAATCAGCTGTCAGCGGAAGAAGATTTTGTTACAACGTATTTATCAGATGGTCAACAAGCAGGTAAATGTACATGTACAACACAGAAGAAGAAGAAGATTCACCGACTCTCTCTCCATAACAGCAACAAATCTTATGCCTCACCAGAAGCAAGAGAACAATTGTCCAAAGTAAGGTCACTCACTATCTTCGGCAAGGTCGACTCGATACCACCCTTGTCGAGCTTTCATGTCCTGCGTGTGTTGCAGATTGAGGACTGCAGTGGTATGGGCAAGAACCATTTTAGTGATCTTGGCAAGCTACGCCTCCTAAGATTTATGCGTCTAGGGTGCTATAGTGCCACCGAGCTCCCTGAAAGCATTGGAAAACTAGAATCTCTCGAAACCCTGGACATAAGAGGTGCTAGATCAAGAACACCATATTATTCTTTTAAATCTCCTAAGGTAGTGTTTCCAATGTCTTTTGTCAAACTAAGGAAACTATTGCGGCTATTTGCTGGCGAAGTGAAGTTGGCGCAAGGTCTGATGCTAGGAAATATGAAATCTTTACAGGAGCTTGAAGTAGAAGCCACACCGGAGGTAATAAAAGAGATTGGTTATTTGAAAGAGCTAAGGACTCTTAGGATCATTGTGAACAGTCAAATCAGTGAGACATTAGAGTTAGTGGAATCCATTCAAACATCTATAAAAAGGCTCACCAATTTGCAAGACCTGGATTTGAGACTAAGTGGTGTACGAGAAACCATAGACATGCAACAGATTCCTTCCGGCCTCCAAAGGTTGTTCATGTTCCGTTTGGACATGGAGGCATTCCCATGTTGGATCAATTCGTCAATGCTCTCCCGCCTCACCGCCTTATCCATTTTGCTGAAGTCTGAATATCTCCAGCCTGACCACCTTGATCGCCTCGCTAAGCTTCCATCTCTTCGTTTTCTGAGGCTAGAATTAGAAGGTGATCCGTTTCGGCTGAAACAACTCACTATCCACAGAGGTGCATGTGCATTCCGGAGTTTAAAATATTTTCACCTTTATAGCTACATGATGCCATCGTTTCAACCAGGAGCTATGCCTCACCTTGAAAGGCTTTGTCTTCTGATTATGACTTTTATAGTGAGGGGTGACTTGAATGATTTAGGTTTGGAGAACCTCCACTCCCTTCGTCATGTAACCATTCATTCCTGTAATGACGAAACCAAGGCTGTTGTTAAAGAGGCACTTAAGGACTGTCCTAATCAAGCAGCTCTCGAATTATACTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0552900 [Oryza sativa (japonica cultivar-group)].

MNVATGAMNTLLPKLGELLVGEYKLQKGVKGEIEELEKELTSMTAALHKVAETPADKLDKLAKIWASDVRELSYDIEDAIDTFMIKGKGHELATSFKKVTNLFNKFKTNHQIHGVIKDIMDQVKKVSERRSRYIVDDIAARPTIVDVDPRLEAMYRKATELVGINEPKSELTKRLLEHDYSSRQQSNIISIVGFGGLGKTTLANSLLQELEAKFDCHFFVSVSLKPDINKILKSILPQLDKKRYAHINEAWETKQFIDEIQDFLKNKRFLCVIDDVWEKSAWDDIKLAVQDAKLGSKIIVTTRNMVVAEHAGGGVYEMKPLSNDDSRQLFCKRIFDSNDDCPGDLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNLDVDNMRKILSLSYNDLPFHLKTCLLSLSKYPEDELIRKDVLIWGWLAEGFITDETRLAGTSLQEIGESYFSELINRSLIQPMDTYFQYEDGKVHECRVHDMVLELINQLSAEEDFVTTYLSDGQQAGKCTCTTQKKKKIHRLSLHNSNKSYASPEAREQLSKVRSLTIFGKVDSIPPLSSFHVLRVLQIEDCSGMGKNHFSDLGKLRLLRFMRLGCYSATELPESIGKLESLETLDIRGARSRTPYYSFKSPKVVFPMSFVKLRKLLRLFAGEVKLAQGLMLGNMKSLQELEVEATPEVIKEIGYLKELRTLRIIVNSQISETLELVESIQTSIKRLTNLQDLDLRLSGVRETIDMQQIPSGLQRLFMFRLDMEAFPCWINSSMLSRLTALSILLKSEYLQPDHLDRLAKLPSLRFLRLELEGDPFRLKQLTIHRGACAFRSLKYFHLYSYMMPSFQPGAMPHLERLCLLIMTFIVRGDLNDLGLENLHSLRHVTIHSCNDETKAVVKEALKDCPNQAALELY

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
144-395 SSF52540

IVDVDPRLEAMYRKATELVGINEPKSELTKRLLEHDYSSRQQSNIISIVGFGGLGKTTLANSLLQELEAKFDCHFFVSVSLKPDINKILKSILPQLDKKRYAHINEAWETKQFIDEIQDFLKNKRFLCVIDDVWEKSAWDDIKLAVQDAKLGSKIIVTTRNMVVAEHAGGGVYEMKPLSNDDSRQLFCKRIFDSNDDCPGDLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNL

Gene3D: G3DSA:3.40.50.300
163-309 G3DSA:3.40.50.300

GINEPKSELTKRLLEHDYSSRQQSNIISIVGFGGLGKTTLANSLLQELEAKFDCHFFVSVSLKPDINKILKSILPQLDKKRYAHINEAWETKQFIDEIQDFLKNKRFLCVIDDVWEKSAWDDIKLAVQDAKLGSKIIVTTRNMVVAE

HMMPfam: PF00931
IPR002182
168-449 NB-ARC,NBS
NB-ARC

KSELTKRLLEHDYSSRQQSNIISIVGFGGLGKTTLANSLLQELEAKFDCHFFVSVSLKPDINKILKSILPQLDKKRYAHINEAWETKQFIDEIQDFLKNKRFLCVIDDVWEKSAWDDIKLAVQDAKLGSKIIVTTRNMVVAEHAGGGVYEMKPLSNDDSRQLFCKRIFDSNDDCPGDLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNLDVDNMRKILSLSYNDLPFHLKTCLLSLSKYPEDELIRKDVLIWGWLAEGFITDE

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

IISIVGFGGLGKTTLA

HMMPanther: PTHR11017
188-815 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IISIVGFGGLGKTTLANSLLQELEAKFDCHFFVSVSLKPDINKILKSILPQLDKKRYAHINEAWETKQFIDEIQDFLKNKRFLCVIDDVWEKSAWDDIKLAVQDAKLGSKIIVTTRNMVVAEHAGGGVYEMKPLSNDDSRQLFCKRIFDSNDDCPGDLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNLDVDNMRKILSLSYNDLPFHLKTCLLSLSKYPEDELIRKDVLIWGWLAEGFITDETRLAGTSLQEIGESYFSELINRSLIQPMDTYFQYEDGKVHECRVHDMVLELINQLSAEEDFVTTYLSDGQQAGKCTCTTQKKKKIHRLSLHNSNKSYASPEAREQLSKVRSLTIFGKVDSIPPLSSFHVLRVLQIEDCSGMGKNHFSDLGKLRLLRFMRLGCYSATELPESIGKLESLETLDIRGARSRTPYYSFKSPKVVFPMSFVKLRKLLRLFAGEVKLAQGLMLGNMKSLQELEVEATPEVIKEIGYLKELRTLRIIVNSQISETLELVESIQTSIKRLTNLQDLDLRLSGVRETIDMQQIPSGLQRLFMFRLDMEAFPCWINSSMLSRLTALSILLKSEYLQPDHLDRLAKLPSLRFLRLE

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

FLKNKRFLCVIDDVW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CGGVPLAIITTACLL

superfamily: SSF52058
492-918 SSF52058,LRR

RVHDMVLELINQLSAEEDFVTTYLSDGQQAGKCTCTTQKKKKIHRLSLHNSNKSYASPEAREQLSKVRSLTIFGKVDSIPPLSSFHVLRVLQIEDCSGMGKNHFSDLGKLRLLRFMRLGCYSATELPESIGKLESLETLDIRGARSRTPYYSFKSPKVVFPMSFVKLRKLLRLFAGEVKLAQGLMLGNMKSLQELEVEATPEVIKEIGYLKELRTLRIIVNSQISETLELVESIQTSIKRLTNLQDLDLRLSGVRETIDMQQIPSGLQRLFMFRLDMEAFPCWINSSMLSRLTALSILLKSEYLQPDHLDRLAKLPSLRFLRLELEGDPFRLKQLTIHRGACAFRSLKYFHLYSYMMPSFQPGAMPHLERLCLLIMTFIVRGDLNDLGLENLHSLRHVTIHSCNDETKAVVKEALKDCPNQAALELY

Gene3D: G3DSA:3.80.10.10
532-761 G3DSA:3.80.10.10

KKIHRLSLHNSNKSYASPEAREQLSKVRSLTIFGKVDSIPPLSSFHVLRVLQIEDCSGMGKNHFSDLGKLRLLRFMRLGCYSATELPESIGKLESLETLDIRGARSRTPYYSFKSPKVVFPMSFVKLRKLLRLFAGEVKLAQGLMLGNMKSLQELEVEATPEVIKEIGYLKELRTLRIIVNSQISETLELVESIQTSIKRLTNLQDLDLRLSGVRETIDMQQIPSGLQRL

FPrintScan: PR00364
IPR000767
622-638 DISEASERSIST
Disease resistance protein

GKLESLETLDIRGARSR

Gene3D: G3DSA:3.80.10.10
778-917 G3DSA:3.80.10.10

SMLSRLTALSILLKSEYLQPDHLDRLAKLPSLRFLRLELEGDPFRLKQLTIHRGACAFRSLKYFHLYSYMMPSFQPGAMPHLERLCLLIMTFIVRGDLNDLGLENLHSLRHVTIHSCNDETKAVVKEALKDCPNQAALEL


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox