PRGDB00049849 (Os12g0516300)

From PRG Wiki
Jump to: navigation, search
Os12g0516300
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488803 (NM_001073421)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0516300 (Os12g0516300) mRNA, complete cds.

DNA Sequence

ATGAACATCGCCACAGGGGCAATGAACACCCTCCTCCCCAAGCTTGGGGAGCTGCTGGTTGGCGAATACAAGCTGCAAAAGGGTGTCAAGGGAGAGATCGAAGAACTTGAGAAAGAGTTGAAAGGTATGACCGCAGCACTCCACAAGGTGGCTGAGACACCTGTGGATCAACTTGACCAGCAGGTCAAGATCTGGGCCAGCGAGGTGAGAGAGCTATCTTACGACATCGAGGATGCCATCGACACCTTCATGTTAAAGTGCAAGGGGCATGAACCTGCCACGAGCTTCAAGAAGGTCACCAATTTGTTCAACAAGTTCAAAACCAACCATCAGATCCACGGTGTCATGAAAGACATCATGGACCAGGTCAAGAAGGTCAGCGAACGTCGTGATAGGTACATAGTCGACGACAATGCTGCCAGGCCAACTGTTGTGGATGTTGATTCTCGCCTAGAAGCTATGTACCGAAAGGCGACAGAACTCATTGGCATTAGCAAGCCAAAAAATGAGCTAACTAAGCAACTCTTGGAATATGACGGCTCATCCAGCCAACAATCAAATATAATTTCTATTGTTGGATTCGGAGGCTTAGGAAAGACAACTCTTGCCAATTCATTATTTCAGGAGCTTAAGGCAAAATTTGACAGCTATTGTTTTGTTTCGGTGTCCTTGAATCCTGATATAAACAAGATTCTCAAGAACATTCTTCTCCAACTTGATGAGAAAATGTATTCCCACATAGATGAAACATGGGAAACGAAGCAGCTCATCGACAAAATTAGAGACTTCCTCAACAATAGAAGGTTCTTGTGCGTGATTGATGATGTATGGAAAAAATCAGCGTGGGATACTATCAAACTTGCTGTGCAAGATGCTAAACTTGGTAGCAAAATAATTGTAACCACGCGAAACAAGGTCGTTGCAGAACATGCAGGCAGTGGTGTTTATGAAATGAAACCCTTATCTGATGATGATTCCAGACAATTGTTCTGCAAACGAATATTTGACTCTAACGATGACTGTCCTGCTGATTTGTGTGGTGTCACTGAGAAAATTTTGAAGAAATGTGGTGGTGTACCGCTAGCAATCATCACTACAGCATGCCTACTTGCTAGCAAACCAAGGAATTCAGAGGAATGGGACAAGGTCAATAAGTCTATCAGTTTGGGGCTTGAGAACAACCTTGATGTGGACAAGATGCGGAAGATATTAAGCCTCAGTTACAACGATCTACCTTTTCATTTGAAGACTTGCTTGTTGTCTCTAAGCAAATATCCTGAGGATGAACTAATTAGAAAAGATGTTTTGATATGGGGTTGGTTAGCTGAGGGTTTTATTACAGATGAAACACGACCTGTAGGGACAAGCTTGCAGGAGATTGGAGAGAGCTACTTCAACGAGCTCATCAATCGAAGCTTGATCCAGCCGATGAGTGAGGACAATTTTTGGGATGAAGATGGTAAGGTGCATGTTTTTTGGGATGAAGATGGTAAGGTGCATGCATGCAAAGTACATGACATGGTGCTTGAGCTAATAAATCAGCTGTCAGTAGAAGAAGATTTTGTTACAACGTATTTATCAGATGGTCAACAAACAGGTAAACATACATGTACAGCACAAAAGAAGAAGATTCGCCGATTATCTCTCCATAACAGCAATAAATCCTATGCCTCACCAGAAGCAAGAGAACAATTGTCCAAAGTAAGGTCCATTACTATCTTCGGCAAGGTCGACTCGATACCACCCTTGTCGAGCTTTCATGTCCTGCGTGTGTTGCAGCTTGAGGACTGCAGTGGAATGGACAAGAACCATCTTAATCATCTCGATAAGCTACGCCTCCTAAGATTTCTGCGTCTAGGGCACTATAGTGCCACTGAGCTCCCTGAAAGCATTGGGAAACTGGAATCTCTCGAAACCTTGGACATAAGAGGTGCACGTAAACCAAGTTCTTTTAAATCTCATAAGGTACTGTTTCCAATGTCTTTTGCCAAACTAAGGAAACTGTTGCGGCTATATGCTGGCAGAGTGAAGCTGGCGCAAGGTCTGATGCTGGGGAATATGAAATCTTTACAGGAGCTTGTAATAGAAGCTACCCGAAAGGTAATAAAAGAGATTGGTAATTTGACAGAGCTAAGGACTCTTAGGATCGTTTTCGGTAGTGAAAAAACATTTGAGTTAAAGGAATCCATTCAAACGTCTATACAAAGGCTCACCAATTTGCAAGACCTAGATTTGAGAAATAATATTAGTTTTGAAGAAATCATAGACATGCAACAGGTTCCTTCCGGTCTCCAAAGGTTGTTCATGCCCGATTCGTTTATGAAAGCATTCCCATGTTGGATCAATTCATTGATGCTCTCCCACCTCACCACCTTATCCATTTGTCTGGATTTCGAATATCTCCAGTCTGACCACCTTGATCGCCTCGCTGAGCTTCCATCTCTTCGCTTTCTCAGGCTACAGTTAGCATTTGTTTCGGAACAACTACAGGAAAAGCTCACTATCCACAGAGGTGCATGTGCATTTCGGAGTTTAAAAGATTTTCAGTTTTATAGCTCCATGATGCCATCGTTTCAACCAGGAGCTATGCCCCACCTTGAAAGGCTTTATCTTTCTATTTGGACCAGACTAAGGAGGGGTGGCTTAAATGATTTAGGTTTGGAGAATCTCTACTCCCTTCGGCATGCAACCATTTATTCCTTTGATGATGACAGCAAGGCTGTTATTGAAGAGGCACTTAAGGACTATCCTAATCAAGCAGCGCTCAAAATACAATCGATGATGATGAACTAA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0516300 [Oryza sativa (japonica cultivar-group)].

MNIATGAMNTLLPKLGELLVGEYKLQKGVKGEIEELEKELKGMTAALHKVAETPVDQLDQQVKIWASEVRELSYDIEDAIDTFMLKCKGHEPATSFKKVTNLFNKFKTNHQIHGVMKDIMDQVKKVSERRDRYIVDDNAARPTVVDVDSRLEAMYRKATELIGISKPKNELTKQLLEYDGSSSQQSNIISIVGFGGLGKTTLANSLFQELKAKFDSYCFVSVSLNPDINKILKNILLQLDEKMYSHIDETWETKQLIDKIRDFLNNRRFLCVIDDVWKKSAWDTIKLAVQDAKLGSKIIVTTRNKVVAEHAGSGVYEMKPLSDDDSRQLFCKRIFDSNDDCPADLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNLDVDKMRKILSLSYNDLPFHLKTCLLSLSKYPEDELIRKDVLIWGWLAEGFITDETRPVGTSLQEIGESYFNELINRSLIQPMSEDNFWDEDGKVHVFWDEDGKVHACKVHDMVLELINQLSVEEDFVTTYLSDGQQTGKHTCTAQKKKIRRLSLHNSNKSYASPEAREQLSKVRSITIFGKVDSIPPLSSFHVLRVLQLEDCSGMDKNHLNHLDKLRLLRFLRLGHYSATELPESIGKLESLETLDIRGARKPSSFKSHKVLFPMSFAKLRKLLRLYAGRVKLAQGLMLGNMKSLQELVIEATRKVIKEIGNLTELRTLRIVFGSEKTFELKESIQTSIQRLTNLQDLDLRNNISFEEIIDMQQVPSGLQRLFMPDSFMKAFPCWINSLMLSHLTTLSICLDFEYLQSDHLDRLAELPSLRFLRLQLAFVSEQLQEKLTIHRGACAFRSLKDFQFYSSMMPSFQPGAMPHLERLYLSIWTRLRRGGLNDLGLENLYSLRHATIYSFDDDSKAVIEEALKDYPNQAALKIQSMMMN

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
36-122 G3DSA:3.40.50.300

LEKELKGMTAALHKVAETPVDQLDQQVKIWASEVRELSYDIEDAIDTFMLKCKGHEPATSFKKVTNLFNKFKTNHQIHGVMKDIMDQ

superfamily: SSF52540
144-395 SSF52540

VVDVDSRLEAMYRKATELIGISKPKNELTKQLLEYDGSSSQQSNIISIVGFGGLGKTTLANSLFQELKAKFDSYCFVSVSLNPDINKILKNILLQLDEKMYSHIDETWETKQLIDKIRDFLNNRRFLCVIDDVWKKSAWDTIKLAVQDAKLGSKIIVTTRNKVVAEHAGSGVYEMKPLSDDDSRQLFCKRIFDSNDDCPADLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNL

Gene3D: G3DSA:3.40.50.300
163-305 G3DSA:3.40.50.300

GISKPKNELTKQLLEYDGSSSQQSNIISIVGFGGLGKTTLANSLFQELKAKFDSYCFVSVSLNPDINKILKNILLQLDEKMYSHIDETWETKQLIDKIRDFLNNRRFLCVIDDVWKKSAWDTIKLAVQDAKLGSKIIVTTRNK

HMMPfam: PF00931
IPR002182
167-449 NB-ARC,NBS
NB-ARC

PKNELTKQLLEYDGSSSQQSNIISIVGFGGLGKTTLANSLFQELKAKFDSYCFVSVSLNPDINKILKNILLQLDEKMYSHIDETWETKQLIDKIRDFLNNRRFLCVIDDVWKKSAWDTIKLAVQDAKLGSKIIVTTRNKVVAEHAGSGVYEMKPLSDDDSRQLFCKRIFDSNDDCPADLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNLDVDKMRKILSLSYNDLPFHLKTCLLSLSKYPEDELIRKDVLIWGWLAEGFITDE

FPrintScan: PR00364
IPR000767
188-203 DISEASERSIST
Disease resistance protein

IISIVGFGGLGKTTLA

HMMPanther: PTHR11017
188-820 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IISIVGFGGLGKTTLANSLFQELKAKFDSYCFVSVSLNPDINKILKNILLQLDEKMYSHIDETWETKQLIDKIRDFLNNRRFLCVIDDVWKKSAWDTIKLAVQDAKLGSKIIVTTRNKVVAEHAGSGVYEMKPLSDDDSRQLFCKRIFDSNDDCPADLCGVTEKILKKCGGVPLAIITTACLLASKPRNSEEWDKVNKSISLGLENNLDVDKMRKILSLSYNDLPFHLKTCLLSLSKYPEDELIRKDVLIWGWLAEGFITDETRPVGTSLQEIGESYFNELINRSLIQPMSEDNFWDEDGKVHVFWDEDGKVHACKVHDMVLELINQLSVEEDFVTTYLSDGQQTGKHTCTAQKKKIRRLSLHNSNKSYASPEAREQLSKVRSITIFGKVDSIPPLSSFHVLRVLQLEDCSGMDKNHLNHLDKLRLLRFLRLGHYSATELPESIGKLESLETLDIRGARKPSSFKSHKVLFPMSFAKLRKLLRLYAGRVKLAQGLMLGNMKSLQELVIEATRKVIKEIGNLTELRTLRIVFGSEKTFELKESIQTSIQRLTNLQDLDLRNNISFEEIIDMQQVPSGLQRLFMPDSFMKAFPCWINSLMLSHLTTLSICLDFEYLQSDHLDRLAELPSLRFLRL

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

FLNNRRFLCVIDDVW

FPrintScan: PR00364
IPR000767
356-370 DISEASERSIST
Disease resistance protein

CGGVPLAIITTACLL

Gene3D: G3DSA:3.80.10.10
542-765 G3DSA:3.80.10.10

KKIRRLSLHNSNKSYASPEAREQLSKVRSITIFGKVDSIPPLSSFHVLRVLQLEDCSGMDKNHLNHLDKLRLLRFLRLGHYSATELPESIGKLESLETLDIRGARKPSSFKSHKVLFPMSFAKLRKLLRLYAGRVKLAQGLMLGNMKSLQELVIEATRKVIKEIGNLTELRTLRIVFGSEKTFELKESIQTSIQRLTNLQDLDLRNNISFEEIIDMQQVPSGLQ

superfamily: SSF52047
542-874 SSF52047,LRR

KKIRRLSLHNSNKSYASPEAREQLSKVRSITIFGKVDSIPPLSSFHVLRVLQLEDCSGMDKNHLNHLDKLRLLRFLRLGHYSATELPESIGKLESLETLDIRGARKPSSFKSHKVLFPMSFAKLRKLLRLYAGRVKLAQGLMLGNMKSLQELVIEATRKVIKEIGNLTELRTLRIVFGSEKTFELKESIQTSIQRLTNLQDLDLRNNISFEEIIDMQQVPSGLQRLFMPDSFMKAFPCWINSLMLSHLTTLSICLDFEYLQSDHLDRLAELPSLRFLRLQLAFVSEQLQEKLTIHRGACAFRSLKDFQFYSSMMPSFQPGAMPHLERLYLSIW

FPrintScan: PR00364
IPR000767
735-751 DISEASERSIST
Disease resistance protein

QRLTNLQDLDLRNNISF

Gene3D: G3DSA:3.80.10.10
801-874 G3DSA:3.80.10.10

LQSDHLDRLAELPSLRFLRLQLAFVSEQLQEKLTIHRGACAFRSLKDFQFYSSMMPSFQPGAMPHLERLYLSIW


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox