PRGDB00049851 (Os12g0510500)

From PRG Wiki
Jump to: navigation, search
Os12g0510500
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488751 (NM_001073395)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0510500 (Os12g0510500) mRNA, partial cds.

DNA Sequence

GCTGGAGAGACCAGCATCAGCCCCATCAGTCGTCATTTCGTCTCCTGTTCCAGGTGGCGGAGTTCATCTTACCACATAGGCAACAATACCATCTTTGGTCTTGAACAAGACACTGATATGATCATGGAAAGGCTGCTCCAACCTACTGAACATCGAGAGGTGATTGTGATAGTTGGCATGGGAGGGATAGGCAAGACAACCCTTGCATCTCTTGTTTTCAACAAGGCTCGTGGAGTTGAAGAAAGGAACACTTGGTCTGGCCAAGCTCCACCCAAAGCAACAGATCCAGGAAGCAGCAGCAAAAGAAGTCATTTTGACGTCTGTGCTTGGGTTCCAGTTGGTCAGGATCCTGATACTCTCCACCTCTTCAGTACCATATCTATTCAGATTGGAGCTAATTTGGATCTATCACGTGATGTGGCTGAAATAAAACATCATATGTTCACCTTTCTGCTTGATAAGAGGTACCTGATTGTTCTGGACGACGTCTGGAGAGAAGAAACATGGCATGAATTGGTTGACGCTTTCCCCATGTCGACAAATGGGAGCAAAATCCTGATGACAACTCGCTCCAAGGTAATAGCCATTTCTGCCGACCCTGCTTCATATCCACATGAGCTGAATCCCTTGAGTGATGAGGTGAGCTTTCACCTCTTCCTATCCAAAGTTTTCCCAAATAGCAACCTTAATCAAGCAATGTCGTATCCACCACTGATGGAGGATTTGGGGCGCCAACTCAGCAAGAAATGTGGTGGTTTACCTCTTGCACTTGTGGTTCTAGGAGGCCTACTATCAGCCAAGGAAAAGAAACACGATGTATGGAGCAGCATACTGAATAGCATGAACTGGAACGACAATGAAGCTGAGAAACAGTGCCTGAAAATATTGGCCTTAAGCTACGACGACTTGCCCTATCGTATGAAACTGTGTTTTCTTTATCTAGGAGCTTTCAGAGAAGAATCTGAAATCAGTATCTCTAAATTGACAAAGCTATGGATTGGAGACGATCTTATACCTCAGCAAAGTGGAAGAAGAAGAAAAGAGGACACGGCCACTGACTATTTAAATGAGCTCATTCAAAGGTGTCTCGTGCAACCTGTTCTTCTGAAACATAAGCAGCGATCAACGAGGGTGCGTGTCCATGCTCTATTGCGTGAGCTAGCAATATCAGAAGGAAGAGAAAACAGATTCCTTTATTGTGAATATAGCAACCAAGCAGTGTCGGAAATGGAGATGGAAACCCTATCGTCGTTTGGTTCTCCATCCGGGACCCAATAA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0510500 [Oryza sativa (japonica cultivar-group)].

AGETSISPISRHFVSCSRWRSSSYHIGNNTIFGLEQDTDMIMERLLQPTEHREVIVIVGMGGIGKTTLASLVFNKARGVEERNTWSGQAPPKATDPGSSSKRSHFDVCAWVPVGQDPDTLHLFSTISIQIGANLDLSRDVAEIKHHMFTFLLDKRYLIVLDDVWREETWHELVDAFPMSTNGSKILMTTRSKVIAISADPASYPHELNPLSDEVSFHLFLSKVFPNSNLNQAMSYPPLMEDLGRQLSKKCGGLPLALVVLGGLLSAKEKKHDVWSSILNSMNWNDNEAEKQCLKILALSYDDLPYRMKLCFLYLGAFREESEISISKLTKLWIGDDLIPQQSGRRRKEDTATDYLNELIQRCLVQPVLLKHKQRSTRVRVHALLRELAISEGRENRFLYCEYSNQAVSEMEMETLSSFGSPSGTQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
6-398 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ISPISRHFVSCSRWRSSSYHIGNNTIFGLEQDTDMIMERLLQPTEHREVIVIVGMGGIGKTTLASLVFNKARGVEERNTWSGQAPPKATDPGSSSKRSHFDVCAWVPVGQDPDTLHLFSTISIQIGANLDLSRDVAEIKHHMFTFLLDKRYLIVLDDVWREETWHELVDAFPMSTNGSKILMTTRSKVIAISADPASYPHELNPLSDEVSFHLFLSKVFPNSNLNQAMSYPPLMEDLGRQLSKKCGGLPLALVVLGGLLSAKEKKHDVWSSILNSMNWNDNEAEKQCLKILALSYDDLPYRMKLCFLYLGAFREESEISISKLTKLWIGDDLIPQQSGRRRKEDTATDYLNELIQRCLVQPVLLKHKQRSTRVRVHALLRELAISEGRENRFL

HMMPanther: PTHR11017:SF126
6-398 PTHR11017:SF126,OS11G0237600 PROTEIN

ISPISRHFVSCSRWRSSSYHIGNNTIFGLEQDTDMIMERLLQPTEHREVIVIVGMGGIGKTTLASLVFNKARGVEERNTWSGQAPPKATDPGSSSKRSHFDVCAWVPVGQDPDTLHLFSTISIQIGANLDLSRDVAEIKHHMFTFLLDKRYLIVLDDVWREETWHELVDAFPMSTNGSKILMTTRSKVIAISADPASYPHELNPLSDEVSFHLFLSKVFPNSNLNQAMSYPPLMEDLGRQLSKKCGGLPLALVVLGGLLSAKEKKHDVWSSILNSMNWNDNEAEKQCLKILALSYDDLPYRMKLCFLYLGAFREESEISISKLTKLWIGDDLIPQQSGRRRKEDTATDYLNELIQRCLVQPVLLKHKQRSTRVRVHALLRELAISEGRENRFL

superfamily: SSF52540
12-283 SSF52540

HFVSCSRWRSSSYHIGNNTIFGLEQDTDMIMERLLQPTEHREVIVIVGMGGIGKTTLASLVFNKARGVEERNTWSGQAPPKATDPGSSSKRSHFDVCAWVPVGQDPDTLHLFSTISIQIGANLDLSRDVAEIKHHMFTFLLDKRYLIVLDDVWREETWHELVDAFPMSTNGSKILMTTRSKVIAISADPASYPHELNPLSDEVSFHLFLSKVFPNSNLNQAMSYPPLMEDLGRQLSKKCGGLPLALVVLGGLLSAKEKKHDVWSSILNSMNW

Gene3D: G3DSA:3.40.50.300
34-193 G3DSA:3.40.50.300

LEQDTDMIMERLLQPTEHREVIVIVGMGGIGKTTLASLVFNKARGVEERNTWSGQAPPKATDPGSSSKRSHFDVCAWVPVGQDPDTLHLFSTISIQIGANLDLSRDVAEIKHHMFTFLLDKRYLIVLDDVWREETWHELVDAFPMSTNGSKILMTTRSKV

HMMPfam: PF00931
IPR002182
35-81 NB-ARC,NBS
NB-ARC

EQDTDMIMERLLQPTEHREVIVIVGMGGIGKTTLASLVFNKARGVEE

FPrintScan: PR00364
IPR000767
54-69 DISEASERSIST
Disease resistance protein

VIVIVGMGGIGKTTLA

HMMPfam: PF00931
IPR002182
100-341 NB-ARC,NBS
NB-ARC

SKRSHFDVCAWVPVGQDPDTLHLFSTISIQIGANLDLSRDVAEIKHHMFTFLLDKRYLIVLDDVWREETWHELVDAFPMSTNGSKILMTTRSKVIAISADPASYPHELNPLSDEVSFHLFLSKVFPNSNLNQAMSYPPLMEDLGRQLSKKCGGLPLALVVLGGLLSAKEKKHDVWSSILNSMNWNDNEAEKQCLKILALSYDDLPYRMKLCFLYLGAFREESEISISKLTKLWIGDDLIPQQ

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

CGGLPLALVVLGGLL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox