PRGDB00049852 (Os12g0500500)

From PRG Wiki
Jump to: navigation, search
Os12g0500500
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488661 (NM_001073350)
Gene Class NL
Domain Type LRR, NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0500500 (Os12g0500500) mRNA, complete cds.

DNA Sequence

ATGGCAGAAGCTCTGATACTAGTATTGCTTCAAAAAATTGCAACCACCCTAAGAGGAGCTGCACAGAAGGCAATCAGCTCACAATTGGGGAAGGAAGCCACCCTTTTGTTTGACGTGGAAAATAGCATGAGAGAAGTTGAGTGTGAATTTGATGTAATGCAGGCCTTTATAAGTCAAGTGGATCCATATTGTACGAATAACCAAGTCTTCCAATCCTGGCTAAAGCATATAAGAATGGTTACCTTTGAAGTTGAGGATATCGTTGATGAATACGCCTTTCTCCTCGGAAAGATGAACGGCACGGAAAGTTTCCTAAGGAAAACACTCCATAAGTCCAAAAAACTCAAGGTGTGGTATAGTGTTGCTTCCCGGCTTAGACAAGTGAAGAGCCGCGTCCAGAACCTAACAGTCATGAAAGAGAGATATGGCATCAAGATATCTGACAATGATGGAACCTCTTCAGGTTGTACCGCTAATCGCCAGATACACTCTTCTAATTCATCGTATTTAAATTATGGTGATGATGATGACAATGCAATGGTGGGACAAAAAGATAACGTGCAAAGACTAACAAAGCATCTGAATGCTTCAGGCATGGATCGTTCTATCATTACCATCCATGGAATGGGAGGATCTGGCAAAACAACTCTTGCAAGGAGCATATACAGGAAGCAAGACATCACAAAGAAATTTGACTGTCATGCATGGATCACAGTGTCACGAAATTACCAGATTGAAGATCTTCTTATGAGCATCATGGATAAGCTTAAGATTGGGCATCGTACTGATATTAATCTTGAAGAAATGGTGCAAGCAATCCACACTTACCTTGAGAACAAAAGGTACCTTATTGTTTTAGATGACATGTGGGATAGAGATTCTTGGTCATGCTTTGAAGATGCATTTCCAAGGAGAAGCCAAGGAAGTAAAGTCATCATTACCACTAGAAACAAAGAAGTTGCCAAATTAGTTGAGTTGCAGGGACATATTATTTCGCTCAACACTCTCCTACCAATAGAATCATGGGACCTCTTTTGCAAAAAGGCATTCTCAAAACTGCCAGAGGCGAAATGCCCTGAAGGTCTCATCAAGCGTGCTGAGGAAATTTTGGAGAAGTGCGAAGGTTTGCCTCTTGCTATTGTAGCTATTGGAAGCCTTCTATCTTACAGGGGCATTGAGGAAAAGGAGTGGGCATCATTTTATGATCAACTAAATTGGCAGCTAACTTATAATCCAGAGCTCAGCAGGGTCTCAAATGTCCTAAGCTCGAGCTTAAATGATCTTCCAACCCATTTGAAGAATTGTTTCCTGTACTGTGGATTATTCCCAGAAGATCGTCTAATTAGGCGTAAGTGGATAATCAGAATGTGGATAGCTGAAGGATTTGTGGAAGATCGAGGAACAGAGACAACATTGGAGGAAGTGGCAGAGGATTATCTGAAGGAACTTACTCAACGATCACTGATTCAGGTTGTTGAAAGGAATGAATTTGGAAGACCAAGAAGGTTTAAATTGCATAACATGGTGAGAGAAATTACTTGGATGATGTCAAAAAGGCAGAGGTTCGCTCTCATATGCGATGACCCAGATGTAACAAGCCTTGGTGATGCAGTGCGCCGTGTGCCTGTACACAAAGGAGGCCAACACTTTCAGCCAAGTGCATCTTGGCAGCAGCTGCGCTCATTTTTGTTATTTGATAAGCACGTATCTATTTCATGGATCTGCAATGCTTCATCAAATTTCAGGCTATTAAGGGTCCTGTGCCTAAGATATTCGCTACTGAAAGATTTCCCAAATGCCATAGTTGGTCTATTCAATCTACACTATCTTGATTTGTCACGGACAAAAGTGAACAAAATACCAAAATCAGTGGCAAGGCTCAAAAACTTGCAGACGCTGCATCTCAGGCGTACATCAGTGAGTGAGTTGCCATGTGAGATTACATTGCTCGCATGCCTCCGCCACCTGTCTGTAAGTACAGACCTATATGGCACATCATTTTCAGGCAATGTTTATGGTCTCAGATCTTTGCATACTCTCAAAGAGATAAAAGCCAGCAAGAATTTAGTCCAAAATCTCAGCTACCTGACACAGCTTCGAAGCTTGAGTATTACTAATGTGCTGGCAAACCACAATAGAGATCTTTGGAGTTCCATCGGAAAGTTGAAATTTCTTACTAGGCTGGCTGTTTCAAGCCGTGATGACGATGAAGTGCTTGACTTGGAAAACTTTAGAGCTCCCCAATATCTGGAGAAGTTCTACTTAGATGCCAAGTTGGCCAACAATGTGCTTTTCCCCATATCTGGGCATTTTCAGAACCTCAAGCTATTGTCAATGCGCTTCTCGCATCTAGTGCAAGATCCTCTCATTTCCTTGTGTAAAATGGCAAACCTTGTTTGCCTTGAGCTGAACTGTGCCTATGATGGGGAGGCGTTGAGGTTCTGTGCTGAATGGTTCCCGAAGCTTAAACAACTCTCCCTGGAGAAGCTGGAAAACTTGAAGTCAATTGACATAATTGATGGCACCATGGTTAACTTAACGTATCTCAAACTTAGCCAACTGTGGAATTTGCATGTTGTGCCGATAGGTCTTACATATCTGAAGATGCTCCACCACTTGTTTGCAGAAAGTATGCCGGATGTCTTCATTAGGGGCTTGGCACGTGAGGGGTTTCTTAACAACAGCATTATCATTGAATGCGTGTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0500500 [Oryza sativa (japonica cultivar-group)].

MAEALILVLLQKIATTLRGAAQKAISSQLGKEATLLFDVENSMREVECEFDVMQAFISQVDPYCTNNQVFQSWLKHIRMVTFEVEDIVDEYAFLLGKMNGTESFLRKTLHKSKKLKVWYSVASRLRQVKSRVQNLTVMKERYGIKISDNDGTSSGCTANRQIHSSNSSYLNYGDDDDNAMVGQKDNVQRLTKHLNASGMDRSIITIHGMGGSGKTTLARSIYRKQDITKKFDCHAWITVSRNYQIEDLLMSIMDKLKIGHRTDINLEEMVQAIHTYLENKRYLIVLDDMWDRDSWSCFEDAFPRRSQGSKVIITTRNKEVAKLVELQGHIISLNTLLPIESWDLFCKKAFSKLPEAKCPEGLIKRAEEILEKCEGLPLAIVAIGSLLSYRGIEEKEWASFYDQLNWQLTYNPELSRVSNVLSSSLNDLPTHLKNCFLYCGLFPEDRLIRRKWIIRMWIAEGFVEDRGTETTLEEVAEDYLKELTQRSLIQVVERNEFGRPRRFKLHNMVREITWMMSKRQRFALICDDPDVTSLGDAVRRVPVHKGGQHFQPSASWQQLRSFLLFDKHVSISWICNASSNFRLLRVLCLRYSLLKDFPNAIVGLFNLHYLDLSRTKVNKIPKSVARLKNLQTLHLRRTSVSELPCEITLLACLRHLSVSTDLYGTSFSGNVYGLRSLHTLKEIKASKNLVQNLSYLTQLRSLSITNVLANHNRDLWSSIGKLKFLTRLAVSSRDDDEVLDLENFRAPQYLEKFYLDAKLANNVLFPISGHFQNLKLLSMRFSHLVQDPLISLCKMANLVCLELNCAYDGEALRFCAEWFPKLKQLSLEKLENLKSIDIIDGTMVNLTYLKLSQLWNLHVVPIGLTYLKMLHHLFAESMPDVFIRGLAREGFLNNSIIIECV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
7-873 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVLLQKIATTLRGAAQKAISSQLGKEATLLFDVENSMREVECEFDVMQAFISQVDPYCTNNQVFQSWLKHIRMVTFEVEDIVDEYAFLLGKMNGTESFLRKTLHKSKKLKVWYSVASRLRQVKSRVQNLTVMKERYGIKISDNDGTSSGCTANRQIHSSNSSYLNYGDDDDNAMVGQKDNVQRLTKHLNASGMDRSIITIHGMGGSGKTTLARSIYRKQDITKKFDCHAWITVSRNYQIEDLLMSIMDKLKIGHRTDINLEEMVQAIHTYLENKRYLIVLDDMWDRDSWSCFEDAFPRRSQGSKVIITTRNKEVAKLVELQGHIISLNTLLPIESWDLFCKKAFSKLPEAKCPEGLIKRAEEILEKCEGLPLAIVAIGSLLSYRGIEEKEWASFYDQLNWQLTYNPELSRVSNVLSSSLNDLPTHLKNCFLYCGLFPEDRLIRRKWIIRMWIAEGFVEDRGTETTLEEVAEDYLKELTQRSLIQVVERNEFGRPRRFKLHNMVREITWMMSKRQRFALICDDPDVTSLGDAVRRVPVHKGGQHFQPSASWQQLRSFLLFDKHVSISWICNASSNFRLLRVLCLRYSLLKDFPNAIVGLFNLHYLDLSRTKVNKIPKSVARLKNLQTLHLRRTSVSELPCEITLLACLRHLSVSTDLYGTSFSGNVYGLRSLHTLKEIKASKNLVQNLSYLTQLRSLSITNVLANHNRDLWSSIGKLKFLTRLAVSSRDDDEVLDLENFRAPQYLEKFYLDAKLANNVLFPISGHFQNLKLLSMRFSHLVQDPLISLCKMANLVCLELNCAYDGEALRFCAEWFPKLKQLSLEKLENLKSIDIIDGTMVNLTYLKLSQLWNLHVVPIGLTYLKMLHHL

HMMPanther: PTHR23155:SF155
7-873 PTHR23155:SF155,OS07G0186500 PROTEIN

LVLLQKIATTLRGAAQKAISSQLGKEATLLFDVENSMREVECEFDVMQAFISQVDPYCTNNQVFQSWLKHIRMVTFEVEDIVDEYAFLLGKMNGTESFLRKTLHKSKKLKVWYSVASRLRQVKSRVQNLTVMKERYGIKISDNDGTSSGCTANRQIHSSNSSYLNYGDDDDNAMVGQKDNVQRLTKHLNASGMDRSIITIHGMGGSGKTTLARSIYRKQDITKKFDCHAWITVSRNYQIEDLLMSIMDKLKIGHRTDINLEEMVQAIHTYLENKRYLIVLDDMWDRDSWSCFEDAFPRRSQGSKVIITTRNKEVAKLVELQGHIISLNTLLPIESWDLFCKKAFSKLPEAKCPEGLIKRAEEILEKCEGLPLAIVAIGSLLSYRGIEEKEWASFYDQLNWQLTYNPELSRVSNVLSSSLNDLPTHLKNCFLYCGLFPEDRLIRRKWIIRMWIAEGFVEDRGTETTLEEVAEDYLKELTQRSLIQVVERNEFGRPRRFKLHNMVREITWMMSKRQRFALICDDPDVTSLGDAVRRVPVHKGGQHFQPSASWQQLRSFLLFDKHVSISWICNASSNFRLLRVLCLRYSLLKDFPNAIVGLFNLHYLDLSRTKVNKIPKSVARLKNLQTLHLRRTSVSELPCEITLLACLRHLSVSTDLYGTSFSGNVYGLRSLHTLKEIKASKNLVQNLSYLTQLRSLSITNVLANHNRDLWSSIGKLKFLTRLAVSSRDDDEVLDLENFRAPQYLEKFYLDAKLANNVLFPISGHFQNLKLLSMRFSHLVQDPLISLCKMANLVCLELNCAYDGEALRFCAEWFPKLKQLSLEKLENLKSIDIIDGTMVNLTYLKLSQLWNLHVVPIGLTYLKMLHHL

superfamily: SSF52540
157-411 SSF52540

TANRQIHSSNSSYLNYGDDDDNAMVGQKDNVQRLTKHLNASGMDRSIITIHGMGGSGKTTLARSIYRKQDITKKFDCHAWITVSRNYQIEDLLMSIMDKLKIGHRTDINLEEMVQAIHTYLENKRYLIVLDDMWDRDSWSCFEDAFPRRSQGSKVIITTRNKEVAKLVELQGHIISLNTLLPIESWDLFCKKAFSKLPEAKCPEGLIKRAEEILEKCEGLPLAIVAIGSLLSYRGIEEKEWASFYDQLNWQLTYN

Gene3D: G3DSA:3.40.50.300
183-322 G3DSA:3.40.50.300

QKDNVQRLTKHLNASGMDRSIITIHGMGGSGKTTLARSIYRKQDITKKFDCHAWITVSRNYQIEDLLMSIMDKLKIGHRTDINLEEMVQAIHTYLENKRYLIVLDDMWDRDSWSCFEDAFPRRSQGSKVIITTRNKEVAK

HMMPfam: PF00931
IPR002182
184-465 NB-ARC,NBS
NB-ARC

KDNVQRLTKHLNASGMDRSIITIHGMGGSGKTTLARSIYRKQDITKKFDCHAWITVSRNYQIEDLLMSIMDKLKIGHRTDINLEEMVQAIHTYLENKRYLIVLDDMWDRDSWSCFEDAFPRRSQGSKVIITTRNKEVAKLVELQGHIISLNTLLPIESWDLFCKKAFSKLPEAKCPEGLIKRAEEILEKCEGLPLAIVAIGSLLSYRGIEEKEWASFYDQLNWQLTYNPELSRVSNVLSSSLNDLPTHLKNCFLYCGLFPEDRLIRRKWIIRMWIAEGFVED

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

IITIHGMGGSGKTTLA

FPrintScan: PR00364
IPR000767
276-290 DISEASERSIST
Disease resistance protein

YLENKRYLIVLDDMW

FPrintScan: PR00364
IPR000767
373-387 DISEASERSIST
Disease resistance protein

CEGLPLAIVAIGSLL

superfamily: SSF52058
504-879 SSF52058,LRR

KLHNMVREITWMMSKRQRFALICDDPDVTSLGDAVRRVPVHKGGQHFQPSASWQQLRSFLLFDKHVSISWICNASSNFRLLRVLCLRYSLLKDFPNAIVGLFNLHYLDLSRTKVNKIPKSVARLKNLQTLHLRRTSVSELPCEITLLACLRHLSVSTDLYGTSFSGNVYGLRSLHTLKEIKASKNLVQNLSYLTQLRSLSITNVLANHNRDLWSSIGKLKFLTRLAVSSRDDDEVLDLENFRAPQYLEKFYLDAKLANNVLFPISGHFQNLKLLSMRFSHLVQDPLISLCKMANLVCLELNCAYDGEALRFCAEWFPKLKQLSLEKLENLKSIDIIDGTMVNLTYLKLSQLWNLHVVPIGLTYLKMLHHLFAESMP

Gene3D: G3DSA:3.80.10.10
557-733 G3DSA:3.80.10.10

QQLRSFLLFDKHVSISWICNASSNFRLLRVLCLRYSLLKDFPNAIVGLFNLHYLDLSRTKVNKIPKSVARLKNLQTLHLRRTSVSELPCEITLLACLRHLSVSTDLYGTSFSGNVYGLRSLHTLKEIKASKNLVQNLSYLTQLRSLSITNVLANHNRDLWSSIGKLKFLTRLAVSSR

FPrintScan: PR00364
IPR000767
625-641 DISEASERSIST
Disease resistance protein

ARLKNLQTLHLRRTSVS

Gene3D: G3DSA:3.80.10.10
764-859 G3DSA:3.80.10.10

LFPISGHFQNLKLLSMRFSHLVQDPLISLCKMANLVCLELNCAYDGEALRFCAEWFPKLKQLSLEKLENLKSIDIIDGTMVNLTYLKLSQLWNLHV


List of References

Hajime Ohyanagi, Tsuyoshi Tanaka, Hiroaki Sakai, Yasumasa Shigemoto, Kaori Yamaguchi, Takuya Habara, Yasuyuki Fujii, Baltazar A Antonio, Yoshiaki Nagamura, Tadashi Imanishi, Kazuho Ikeo, Takeshi Itoh, Takashi Gojobori, Takuji Sasaki
The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information.
Nucleic Acids Res.: 2006, 34(Database issue);D741-4
PubMed:16381971 WorldCat.org DOI (I p)


The map-based sequence of the rice genome.
Nature: 2005, 436(7052);793-800
PubMed:16100779 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox