PRGDB00049853 (Os12g0495600)

From PRG Wiki
Jump to: navigation, search
Os12g0495600
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 115488633 (NM_001073336)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) Os12g0495600 (Os12g0495600) mRNA, complete cds.

DNA Sequence

ATGGAAGGACCTGTGAGCGCGTCGATGGGTGTCATGGTCCCTTTGCTGTCCAAGCTCATCGAGAGCATGGAACAGCCGAGGTTCAAGGACCTGAAGAACGACTTGAAGTCCCTCAGGGCCGAGCTCGCATCCATGGAAGCTGTAATGCTCAAGTTCGCCACGCAGGACGACACTGACCTGCAGGTGAAGGAGTGGATGAGGCAGGTGCGGGAAGTGGGCTACGACACCGATGACTGGATCGACAGCCACCCTCTGGTGGCTGCGGAGACGAAGGGGTCACGCATCTTCAGCCGGAACAACCGGCGGAGGAAGCTCGCTGAGCTGATAAAGGAGCTCAAGGACCGCGTCGAGGATGCCAGCCAAAGGCGGACCAGGTACATGCTCCAGAGCGCCCCTGTCGTGGACGACGTCACCGACGACCTCCGCCCCAGCAACGTCACCGTCGACCCTCAGCTTCTGTACGGTGTTAGCCGTAGGCTGGTTGGACTGGATGAGCCTATGGAGGAGCTCGTCCGCGAACTGAGGCCTGGCGGCGGCGAGCAGCAGCACTTCAAGGTGGTGTCCATCGTCGGAGGCGGTGGCCTTGGCAAGACCACGCTCGCCAAGGAGGTGTACCGAAAGATCCACGGCGAATTTGTCTCTTGTGCATTCGTCACTGTCGGCCAGAACCCGCATATTCCGACGGTTCTGCTCAACATGCTCCGCCAGCTCAACCCCCTGCAGCCGCAAGGGGATGACACTGAGCAACAGATGGATGAACCCACAGTAGTCGGCAAGATCAGGGAGTTCCTCGACAAAAAGAGGTACTTTATCACCATTGACGATATATGGAGTATATCTGCTTGGAAGGACATCAAATACGCTCTACCCGAGAATACTCCTGGAAGTAGAATAGTGGCCACGACACGTATCAGCGATGTAGCGAAATCGTGTTCCGTCCGCCCCACGGATTTCACCTATCCGATGAAGCATCTTAGCAAGACTGACTCCAAGCAACTGTTTCTCGGCAGACTGCAGTCTCCTAAGAAAATTTACTCTTCTGAGACTGACCTGGAAGAAGGGGTTTTCCATGATGTTTGGAACATATGCGGCGGCATGCCACTAGCGATGATCGTCATTGCCGGTATGCTGAACAGGAAATCGCCAGGCTGCCCTGAGGACAATAAAAGCATCAAGAAAGCACTGGAGAAACACCCGACGTTGCAAGGGATGAGGAGGATACTACGCATCTGTTACTCTGATCTCTCTTTACCCGTGAGAACTTGCTTGCTGTATCTGAGCATCTTCCGGCCGGAGGATGAAACGGTGGAGAAGAACCGGCTGATATGGAGGTGGATAGCCGAAAGGTTCATCCCAGTCCTAAAGCAGGAGCAGGTCACGTTATGGGAGACGGCCGAGAGCTACTTCAACGAGCTCGTCAACCGACAGCTGATCCAGCCGGTGGAGGCGGGGGACGTCGTGAAGGTGAAGGTGCACGACGTGGTCCTCGAGTTCATCGCGTCTGTCGCTGCCGAGGAGAACTTCGTCACCTCGGACATGGTGCTGCGTTGCAAGCCACGTGACATCGTCCGGCGGGCCTCCCTCAACTGCATCGACGACGACGAGAGCACCGGAGGCCTGTCTCAGGTCCGTTCGCTGACGGTGTTCGGCGTCCTCGCCGAGCCCATGAAATCGAGCATCGTCTACTTGCAGCTGCTGCGAGTGCTCGACTTCAAAGACGCCAAGGGGCTGAAAGATGAAGATGTACAAGGTCTCGAGAGGCTCTTCTTCCTCAAGTACCTTGGGCTCGGCGGCAAGTTCGTCACAAAGCTCCCAGAGAAGTGGAAGGAGCTCCAGAACTTGGAAGCCCTGGATGTGAGGGAGACCGCCGTCAAGGAGCTTCCAGAGGCGATCGCCCGGCGGTGTAGCAAGCTGGCGTGCCTGCTCGCCCGTCGCCTCGCCGTCGGGGAGGGGATGCACAGCTTGCTGCACCTGCAGGAGCTGTCTATGGTGAGCGTCACCGATGCGGCCTCGCTGGACCGCATGACTAATCTGGTGGTGGGCCTGACCAAGCTGAGGAAGCTTGGCGTGAGTTTGTTTTTCGACGCCACGGGCGACCAGCACCAGCACGCCGTGGCCGCCGCTGCTCCCGACGACGCCAAGCTCGCCGCCTCCCTCGAGCGGATCGAGAAATGCGGCGTCGAGTCGCTCCTCCTGGACGTCGTCGGCGAGGGCAAGACGCGCGCGGCGCTGGATCAGCTCGTGGAGAAGTGGGCACTGCCGCGTCGCCTGCAGAAATTCACCATGAGGAGCGAGCACTACTACTTCCCCAAGGCGCCGCCCAAGATGGCCCCTCACGAATCCCTCTCCCACCTCGAGATCTCCATAGCCGAGCTAAGGAAGAGCGACGTCGGCGTGCTCTGCACCATGCCTTCCCTCTTCTACCTCAAGTTGAGCACAAGATCGTCTCCGCTGGAGGCGGATCAGACGGTGGTCATCACCAACGTGGGATTCCAGTGCCTCCAGGTGTTCTGGTTCAAGTGCCAGGACGGCGGCCTGGGGTTCGACTTCGGAGACGGAGCCATGGCCCAGCTTCTGAAGCTTGATCTCCACTTCAAGCAGGCGAAGAAGCCCAAGCTTACCGGCATCAGCAACCTCTCTTCGCTCCGGCAATTCCACGCCACCGTCTGCTGCGGTAAAGATGATTCAGAATTTAAGGCTACAGAAGAAAACATCAAGCAAATCGTATCAAATCACTCCAAGAATCCCACCTGGGAGGTCACCATGGAGATGGAGATCGACAAGCCTACTGCAGCCATCTCAATTTGA


Protein sequences

Name Description Sequence
hypothetical protein Os12g0495600 [Oryza sativa (japonica cultivar-group)].

MEGPVSASMGVMVPLLSKLIESMEQPRFKDLKNDLKSLRAELASMEAVMLKFATQDDTDLQVKEWMRQVREVGYDTDDWIDSHPLVAAETKGSRIFSRNNRRRKLAELIKELKDRVEDASQRRTRYMLQSAPVVDDVTDDLRPSNVTVDPQLLYGVSRRLVGLDEPMEELVRELRPGGGEQQHFKVVSIVGGGGLGKTTLAKEVYRKIHGEFVSCAFVTVGQNPHIPTVLLNMLRQLNPLQPQGDDTEQQMDEPTVVGKIREFLDKKRYFITIDDIWSISAWKDIKYALPENTPGSRIVATTRISDVAKSCSVRPTDFTYPMKHLSKTDSKQLFLGRLQSPKKIYSSETDLEEGVFHDVWNICGGMPLAMIVIAGMLNRKSPGCPEDNKSIKKALEKHPTLQGMRRILRICYSDLSLPVRTCLLYLSIFRPEDETVEKNRLIWRWIAERFIPVLKQEQVTLWETAESYFNELVNRQLIQPVEAGDVVKVKVHDVVLEFIASVAAEENFVTSDMVLRCKPRDIVRRASLNCIDDDESTGGLSQVRSLTVFGVLAEPMKSSIVYLQLLRVLDFKDAKGLKDEDVQGLERLFFLKYLGLGGKFVTKLPEKWKELQNLEALDVRETAVKELPEAIARRCSKLACLLARRLAVGEGMHSLLHLQELSMVSVTDAASLDRMTNLVVGLTKLRKLGVSLFFDATGDQHQHAVAAAAPDDAKLAASLERIEKCGVESLLLDVVGEGKTRAALDQLVEKWALPRRLQKFTMRSEHYYFPKAPPKMAPHESLSHLEISIAELRKSDVGVLCTMPSLFYLKLSTRSSPLEADQTVVITNVGFQCLQVFWFKCQDGGLGFDFGDGAMAQLLKLDLHFKQAKKPKLTGISNLSSLRQFHATVCCGKDDSEFKATEENIKQIVSNHSKNPTWEVTMEMEIDKPTAAISI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
12-573 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MVPLLSKLIESMEQPRFKDLKNDLKSLRAELASMEAVMLKFATQDDTDLQVKEWMRQVREVGYDTDDWIDSHPLVAAETKGSRIFSRNNRRRKLAELIKELKDRVEDASQRRTRYMLQSAPVVDDVTDDLRPSNVTVDPQLLYGVSRRLVGLDEPMEELVRELRPGGGEQQHFKVVSIVGGGGLGKTTLAKEVYRKIHGEFVSCAFVTVGQNPHIPTVLLNMLRQLNPLQPQGDDTEQQMDEPTVVGKIREFLDKKRYFITIDDIWSISAWKDIKYALPENTPGSRIVATTRISDVAKSCSVRPTDFTYPMKHLSKTDSKQLFLGRLQSPKKIYSSETDLEEGVFHDVWNICGGMPLAMIVIAGMLNRKSPGCPEDNKSIKKALEKHPTLQGMRRILRICYSDLSLPVRTCLLYLSIFRPEDETVEKNRLIWRWIAERFIPVLKQEQVTLWETAESYFNELVNRQLIQPVEAGDVVKVKVHDVVLEFIASVAAEENFVTSDMVLRCKPRDIVRRASLNCIDDDESTGGLSQVRSLTVFGVLAEPMKSSIVYLQLLRVLDFKD

HMMPanther: PTHR11017:SF126
12-573 PTHR11017:SF126,OS11G0237600 PROTEIN

MVPLLSKLIESMEQPRFKDLKNDLKSLRAELASMEAVMLKFATQDDTDLQVKEWMRQVREVGYDTDDWIDSHPLVAAETKGSRIFSRNNRRRKLAELIKELKDRVEDASQRRTRYMLQSAPVVDDVTDDLRPSNVTVDPQLLYGVSRRLVGLDEPMEELVRELRPGGGEQQHFKVVSIVGGGGLGKTTLAKEVYRKIHGEFVSCAFVTVGQNPHIPTVLLNMLRQLNPLQPQGDDTEQQMDEPTVVGKIREFLDKKRYFITIDDIWSISAWKDIKYALPENTPGSRIVATTRISDVAKSCSVRPTDFTYPMKHLSKTDSKQLFLGRLQSPKKIYSSETDLEEGVFHDVWNICGGMPLAMIVIAGMLNRKSPGCPEDNKSIKKALEKHPTLQGMRRILRICYSDLSLPVRTCLLYLSIFRPEDETVEKNRLIWRWIAERFIPVLKQEQVTLWETAESYFNELVNRQLIQPVEAGDVVKVKVHDVVLEFIASVAAEENFVTSDMVLRCKPRDIVRRASLNCIDDDESTGGLSQVRSLTVFGVLAEPMKSSIVYLQLLRVLDFKD

superfamily: SSF52540
136-379 SSF52540

DVTDDLRPSNVTVDPQLLYGVSRRLVGLDEPMEELVRELRPGGGEQQHFKVVSIVGGGGLGKTTLAKEVYRKIHGEFVSCAFVTVGQNPHIPTVLLNMLRQLNPLQPQGDDTEQQMDEPTVVGKIREFLDKKRYFITIDDIWSISAWKDIKYALPENTPGSRIVATTRISDVAKSCSVRPTDFTYPMKHLSKTDSKQLFLGRLQSPKKIYSSETDLEEGVFHDVWNICGGMPLAMIVIAGMLNR

Gene3D: G3DSA:3.40.50.300
159-304 G3DSA:3.40.50.300

RLVGLDEPMEELVRELRPGGGEQQHFKVVSIVGGGGLGKTTLAKEVYRKIHGEFVSCAFVTVGQNPHIPTVLLNMLRQLNPLQPQGDDTEQQMDEPTVVGKIREFLDKKRYFITIDDIWSISAWKDIKYALPENTPGSRIVATTRI

HMMPfam: PF00931
IPR002182
167-453 NB-ARC,NBS
NB-ARC

MEELVRELRPGGGEQQHFKVVSIVGGGGLGKTTLAKEVYRKIHGEFVSCAFVTVGQNPHIPTVLLNMLRQLNPLQPQGDDTEQQMDEPTVVGKIREFLDKKRYFITIDDIWSISAWKDIKYALPENTPGSRIVATTRISDVAKSCSVRPTDFTYPMKHLSKTDSKQLFLGRLQSPKKIYSSETDLEEGVFHDVWNICGGMPLAMIVIAGMLNRKSPGCPEDNKSIKKALEKHPTLQGMRRILRICYSDLSLPVRTCLLYLSIFRPEDETVEKNRLIWRWIAERFIPV

FPrintScan: PR00364
IPR000767
186-201 DISEASERSIST
Disease resistance protein

VVSIVGGGGLGKTTLA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

FLDKKRYFITIDDIW

FPrintScan: PR00364
IPR000767
363-377 DISEASERSIST
Disease resistance protein

CGGMPLAMIVIAGML

superfamily: SSF52058
490-812 SSF52058,LRR

KVHDVVLEFIASVAAEENFVTSDMVLRCKPRDIVRRASLNCIDDDESTGGLSQVRSLTVFGVLAEPMKSSIVYLQLLRVLDFKDAKGLKDEDVQGLERLFFLKYLGLGGKFVTKLPEKWKELQNLEALDVRETAVKELPEAIARRCSKLACLLARRLAVGEGMHSLLHLQELSMVSVTDAASLDRMTNLVVGLTKLRKLGVSLFFDATGDQHQHAVAAAAPDDAKLAASLERIEKCGVESLLLDVVGEGKTRAALDQLVEKWALPRRLQKFTMRSEHYYFPKAPPKMAPHESLSHLEISIAELRKSDVGVLCTMPSLFYLKLS

Gene3D: G3DSA:3.80.10.10
540-691 G3DSA:3.80.10.10

LSQVRSLTVFGVLAEPMKSSIVYLQLLRVLDFKDAKGLKDEDVQGLERLFFLKYLGLGGKFVTKLPEKWKELQNLEALDVRETAVKELPEAIARRCSKLACLLARRLAVGEGMHSLLHLQELSMVSVTDAASLDRMTNLVVGLTKLRKLGVS

FPrintScan: PR00364
IPR000767
561-577 DISEASERSIST
Disease resistance protein

VYLQLLRVLDFKDAKGL


List of References




List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox